mRNA_D-mesarthrocarpus_Contig10144.1.1 (mRNA) Discosporangium mesarthrocarpum MT17_79
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_D-mesarthrocarpus_Contig10144.1.1 vs. uniprot
Match: A0A5K3FYK6_MESCO (DNA-directed DNA polymerase n=1 Tax=Mesocestoides corti TaxID=53468 RepID=A0A5K3FYK6_MESCO) HSP 1 Score: 51.6 bits (122), Expect = 7.030e-5 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 58 PTPSSSGT--YTGATVFEPVTGLFDE-IKAYDFASFYPSIILCANV 186 PT S+G YTGATVFEPV G +DE I DF+SFYPSII+ N+ Sbjct: 376 PTVKSNGRDEYTGATVFEPVCGFYDEPIITLDFSSFYPSIIIAHNL 421
BLAST of mRNA_D-mesarthrocarpus_Contig10144.1.1 vs. uniprot
Match: A0A5K3FTS7_MESCO (DNA-directed DNA polymerase n=4 Tax=Mesocestoides corti TaxID=53468 RepID=A0A5K3FTS7_MESCO) HSP 1 Score: 51.6 bits (122), Expect = 7.260e-5 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 58 PTPSSSGT--YTGATVFEPVTGLFDE-IKAYDFASFYPSIILCANV 186 PT S+G YTGATVFEPV G +DE I DF+SFYPSII+ N+ Sbjct: 539 PTVKSNGRDEYTGATVFEPVCGFYDEPIITLDFSSFYPSIIIAHNL 584
BLAST of mRNA_D-mesarthrocarpus_Contig10144.1.1 vs. uniprot
Match: A0A6C0JKJ5_9ZZZZ (DNA-directed DNA polymerase n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0JKJ5_9ZZZZ) HSP 1 Score: 51.6 bits (122), Expect = 7.430e-5 Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 64 PSSSGTYTGATVFEPVTGLFDEIKAYDFASFYPSIILCANV 186 P Y GATVFEPV G++D++ +DFAS YPS I+ N+ Sbjct: 485 PKDDDHYVGATVFEPVAGVYDKVLPFDFASLYPSTIIAYNI 525
BLAST of mRNA_D-mesarthrocarpus_Contig10144.1.1 vs. uniprot
Match: A0A0R3U9G7_MESCO (DNA-directed DNA polymerase n=3 Tax=Mesocestoides corti TaxID=53468 RepID=A0A0R3U9G7_MESCO) HSP 1 Score: 51.6 bits (122), Expect = 7.440e-5 Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 58 PTPSSSGT--YTGATVFEPVTGLFDE-IKAYDFASFYPSIILCANV 186 PT S+G YTGATVFEPV G +DE I DF+SFYPSII+ N+ Sbjct: 539 PTVKSNGRDEYTGATVFEPVCGFYDEPIITLDFSSFYPSIIIAHNL 584 The following BLAST results are available for this feature:
BLAST of mRNA_D-mesarthrocarpus_Contig10144.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-mesarthrocarpus_Contig10144.1.1 >prot_D-mesarthrocarpus_Contig10144.1.1 ID=prot_D-mesarthrocarpus_Contig10144.1.1|Name=mRNA_D-mesarthrocarpus_Contig10144.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=polypeptide|length=137bp MSLMSFQYSRGKVIDWTPTPSSSGTYTGATVFEPVTGLFDEIKAYDFASFback to top mRNA from alignment at D-mesarthrocarpus_Contig10144:250..666+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-mesarthrocarpus_Contig10144.1.1 ID=mRNA_D-mesarthrocarpus_Contig10144.1.1|Name=mRNA_D-mesarthrocarpus_Contig10144.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=mRNA|length=417bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10144:250..666+ (Discosporangium mesarthrocarpum MT17_79)back to top Coding sequence (CDS) from alignment at D-mesarthrocarpus_Contig10144:250..666+ >mRNA_D-mesarthrocarpus_Contig10144.1.1 ID=mRNA_D-mesarthrocarpus_Contig10144.1.1|Name=mRNA_D-mesarthrocarpus_Contig10144.1.1|organism=Discosporangium mesarthrocarpum MT17_79|type=CDS|length=411bp|location=Sequence derived from alignment at D-mesarthrocarpus_Contig10144:250..666+ (Discosporangium mesarthrocarpum MT17_79)back to top |