mRNA_D-dichotoma_M_contig943.20158.1 (mRNA) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A6H5KT20_9PHAE (FtsJ domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KT20_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 1.890e-22 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 1 Query: 91 VDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGFL 276 ++G G GLLARGGTFLGKF AGRDERE+KEEA +LF++V+VVKPPASRS S EMYLLATGFL Sbjct: 473 IEGEGPGLLARGGTFLGKFFAGRDEREVKEEAERLFERVKVVKPPASRSGSGEMYLLATGFL 534
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A6L7XH06_9PROT (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Rhodospirillales bacterium TaxID=2026786 RepID=A0A6L7XH06_9PROT) HSP 1 Score: 73.9 bits (180), Expect = 5.670e-14 Identity = 48/91 (52.75%), Postives = 56/91 (61.54%), Query Frame = 1 Query: 4 ASVVLSDMAPSFSGDRDMDQGR-LDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 A VLSDMAP +G R DQ R L A VD + LLA GGT L K + G+ E +L G F +VR KPPASRS SSEM+LLA+GF Sbjct: 135 ADAVLSDMAPPATGHRSTDQLRSLALAEAAVD-CAAALLAPGGTLLVKLIRGQGEEDLVRALGDTFAEVRREKPPASRSDSSEMFLLASGF 224
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A0D0PZK0_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Wenxinia marina DSM 24838 TaxID=1123501 RepID=A0A0D0PZK0_9RHOB) HSP 1 Score: 73.2 bits (178), Expect = 1.350e-13 Identity = 44/91 (48.35%), Postives = 56/91 (61.54%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 +A VV+SDMA S SG + D R+ + +LA GGTF+ K LAG E EL++ Q F KV VKPPASR+ SSE ++LATGF Sbjct: 145 QADVVMSDMAASSSGHKQTDHIRIIALCEAAAELAFDVLAPGGTFVAKVLAGGAEGELQKRLKQAFTKVENVKPPASRADSSEKFVLATGF 235
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A0L0FC24_9EUKA (Ribosomal RNA large subunit methyltransferase J (Fragment) n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FC24_9EUKA) HSP 1 Score: 70.1 bits (170), Expect = 3.050e-13 Identity = 43/93 (46.24%), Postives = 53/93 (56.99%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGFLE 279 RA VVLSDMAP SG +D RL V G L GGT + K L G D ++ + Q FQ V+ KP ASRSSSSE +++ATGF + Sbjct: 31 RADVVLSDMAPPASGQPSVDFDRLMNLCDAVLNFTKGNLKPGGTLVVKLLGGGDIKDFRTSLTQTFQSVKFAKPAASRSSSSESFVVATGFTQ 123
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A4Q3Y9A2_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Loktanella sp. IMCC34160 TaxID=2510646 RepID=A0A4Q3Y9A2_9RHOB) HSP 1 Score: 71.6 bits (174), Expect = 4.810e-13 Identity = 44/90 (48.89%), Postives = 56/90 (62.22%), Query Frame = 1 Query: 4 ASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 A VV+SDMA S SG + D R+ + +LA GGTF+ K LAG E EL++ Q F+KV VKPPASRS SSE +++ATGF Sbjct: 147 ADVVMSDMAASSSGHKQTDHLRIIALCEAAAYLAFDVLAPGGTFVAKVLAGGAEGELQKLLKQRFEKVANVKPPASRSDSSEKFVVATGF 236
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: UPI000F8D4DB7 (RlmE family RNA methyltransferase n=1 Tax=Pararhodobacter zhoushanensis TaxID=2479545 RepID=UPI000F8D4DB7) HSP 1 Score: 70.9 bits (172), Expect = 1.120e-12 Identity = 44/91 (48.35%), Postives = 55/91 (60.44%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 +A VV+SDMA S SG + D R+ +LA GGTF+ K LAG E EL++ Q F KV VKPPASR+ SSE Y++ATGF Sbjct: 155 QADVVMSDMAASASGHKQTDHNRIMALCEHAAYFAFDVLAPGGTFVAKVLAGGAEGELQQLLKQRFTKVVNVKPPASRADSSEKYVVATGF 245
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A1H8PV46_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Salinihabitans flavidus TaxID=569882 RepID=A0A1H8PV46_9RHOB) HSP 1 Score: 70.5 bits (171), Expect = 1.210e-12 Identity = 42/91 (46.15%), Postives = 55/91 (60.44%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 +A VV+SDMA S SG + D R+ +L GGTF+ K LAG E EL++ Q F+KV +KPPASRS SSE +++ATGF Sbjct: 141 KADVVMSDMAASSSGHKQTDHLRIISLCDAAAEFAFDVLEVGGTFVAKVLAGGAEGELQKRLKQRFEKVANIKPPASRSDSSEKFVVATGF 231
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A2G2B3C4_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Marinosulfonomonas sp. TaxID=2030815 RepID=A0A2G2B3C4_9RHOB) HSP 1 Score: 70.5 bits (171), Expect = 1.240e-12 Identity = 44/91 (48.35%), Postives = 55/91 (60.44%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 RA VV+SDMA S SG + D R+ +L GGTF+ K LAG E EL++ Q F KV VKPPASRS+SSE +++ATGF Sbjct: 141 RADVVMSDMAASASGHKQTDHIRIIALCETAAYFAFDVLEEGGTFVAKVLAGGAEGELQKLLKQQFNKVVNVKPPASRSTSSEKFVVATGF 231
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A365U4Q7_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Rhodosalinus halophilus TaxID=2259333 RepID=A0A365U4Q7_9RHOB) HSP 1 Score: 70.5 bits (171), Expect = 1.260e-12 Identity = 43/91 (47.25%), Postives = 54/91 (59.34%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 RA VV+SDMA + SG + D R+ + +L GGTF+ K LAG E L+ E + F KV VKPPASRS SSE Y++ATGF Sbjct: 143 RADVVMSDMAAASSGHKQTDHLRIVALCEAAAQLAFDVLEEGGTFVAKVLAGGAEDALQAELKRRFAKVSNVKPPASRSDSSEKYVVATGF 233
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Match: A0A7C6F5J8_9RHOB (Ribosomal RNA large subunit methyltransferase E n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A7C6F5J8_9RHOB) HSP 1 Score: 70.5 bits (171), Expect = 1.280e-12 Identity = 45/94 (47.87%), Postives = 58/94 (61.70%), Query Frame = 1 Query: 1 RASVVLSDMAPSFSGDRDMDQGRLDEDPAIVDG---IGSGLLARGGTFLGKFLAGRDERELKEEAGQLFQKVRVVKPPASRSSSSEMYLLATGF 273 RA VV+SDMA S SG + D R+ A+ D + +L GGTF+ K LAG E +L++ + F KV VKPPASRS SSE Y++ATGF Sbjct: 141 RADVVMSDMAASSSGHKQTDHLRI---IALCDAAAELAFDILEEGGTFVAKVLAGGAEGDLQKRLKRHFAKVVNVKPPASRSDSSEKYVVATGF 231 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig943.20158.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dichotoma_M_contig943.20158.1 >prot_D-dichotoma_M_contig943.20158.1 ID=prot_D-dichotoma_M_contig943.20158.1|Name=mRNA_D-dichotoma_M_contig943.20158.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=87bp MAPSFSGDRDMDQGRLDEDPAIVDGIGSGLLARGGTFLGKFLAGRDERELback to top mRNA from alignment at D-dichotoma_M_contig943:15766..16113+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dichotoma_M_contig943.20158.1 ID=mRNA_D-dichotoma_M_contig943.20158.1|Name=mRNA_D-dichotoma_M_contig943.20158.1|organism=Dictyota dichotoma ODC1387m male|type=mRNA|length=348bp|location=Sequence derived from alignment at D-dichotoma_M_contig943:15766..16113+ (Dictyota dichotoma ODC1387m male)back to top Coding sequence (CDS) from alignment at D-dichotoma_M_contig943:15766..16113+ >mRNA_D-dichotoma_M_contig943.20158.1 ID=mRNA_D-dichotoma_M_contig943.20158.1|Name=mRNA_D-dichotoma_M_contig943.20158.1|organism=Dictyota dichotoma ODC1387m male|type=CDS|length=522bp|location=Sequence derived from alignment at D-dichotoma_M_contig943:15766..16113+ (Dictyota dichotoma ODC1387m male)back to top |