prot_D-dichotoma_M_contig1005.135.1 (polypeptide) Dictyota dichotoma ODC1387m male
Overview
Homology
BLAST of mRNA_D-dichotoma_M_contig1005.135.1 vs. uniprot
Match: D7G9H4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9H4_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 8.200e-8 Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 17 MVKKWAVGAMINISGSIAINLGTNLMKLSHKLEETE 52 MV+KWA+GAMINISGSIAINLGTNLMKLSHK+++ E Sbjct: 1 MVQKWAIGAMINISGSIAINLGTNLMKLSHKMKKGE 36
BLAST of mRNA_D-dichotoma_M_contig1005.135.1 vs. uniprot
Match: A0A6H5K6Y8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6Y8_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 2.300e-7 Identity = 29/36 (80.56%), Postives = 34/36 (94.44%), Query Frame = 0 Query: 17 MVKKWAVGAMINISGSIAINLGTNLMKLSHKLEETE 52 MV+KWA+G MINISGSIAINLGTNLMKLSHK+++ E Sbjct: 1 MVQKWAIGTMINISGSIAINLGTNLMKLSHKMKKGE 36 The following BLAST results are available for this feature:
BLAST of mRNA_D-dichotoma_M_contig1005.135.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dichotoma_M_contig1005.135.1 ID=prot_D-dichotoma_M_contig1005.135.1|Name=mRNA_D-dichotoma_M_contig1005.135.1|organism=Dictyota dichotoma ODC1387m male|type=polypeptide|length=322bpback to top |