prot_D-dudresnayi_contig10356.377.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10356.377.1 vs. uniprot
Match: D8LQQ1_ECTSI (PHD-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQQ1_ECTSI) HSP 1 Score: 90.9 bits (224), Expect = 3.130e-15 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 0 Query: 518 FIPDKMVSVDMGAAWIHGTSGNPVTALCEKCSLSMFNTGSPTLFVDYNGR 567 F+PDKMVSVDMGAAWIHGT+ NP+TALCEK SL +FNTGSPT+ VD++GR Sbjct: 795 FVPDKMVSVDMGAAWIHGTTKNPITALCEKFSLGLFNTGSPTVMVDHDGR 844
BLAST of mRNA_D-dudresnayi_contig10356.377.1 vs. uniprot
Match: A0A6H5KIY4_9PHAE (PHD-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIY4_9PHAE) HSP 1 Score: 90.9 bits (224), Expect = 3.400e-15 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 0 Query: 518 FIPDKMVSVDMGAAWIHGTSGNPVTALCEKCSLSMFNTGSPTLFVDYNGR 567 F+PDKMVSVDMGAAWIHGT+ NP+TALCEK SL +FNTGSPT+ VD++GR Sbjct: 1006 FVPDKMVSVDMGAAWIHGTTKNPITALCEKFSLGLFNTGSPTVMVDHDGR 1055 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10356.377.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10356.377.1 ID=prot_D-dudresnayi_contig10356.377.1|Name=mRNA_D-dudresnayi_contig10356.377.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=568bpback to top |