prot_D-dudresnayi_contig9920.28733.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9920.28733.1 vs. uniprot
Match: A0A6H5L887_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L887_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 3.520e-5 Identity = 57/113 (50.44%), Postives = 65/113 (57.52%), Query Frame = 0 Query: 1 MTTLASIAD--NSASTSAFPLIGRSGGAFSPILGDPMSDNSNXXXXXXXXXXXXXVGATIVGGGVENVGAGGSDTAAASAHARWNKRELETGG--GQEPRPTKRMSPIPTRPH 109 MTTLAS D +AS P I R GGAFSP LGDPMSD+ XXXXXXXXXXXXX G+ + RW KR+LE GG Q+P P KR SP+P +PH Sbjct: 1 MTTLASTLDAKKAASPLVSPCIRRLGGAFSPALGDPMSDDGXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNGN------VNGRW-KRDLEPGGCEEQQPPPAKRASPVPRKPH 106 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9920.28733.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9920.28733.1 ID=prot_D-dudresnayi_contig9920.28733.1|Name=mRNA_D-dudresnayi_contig9920.28733.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=124bpback to top |