prot_D-dudresnayi_contig9687.28475.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: D7FYZ2_ECTSI (GBBH-like_N domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYZ2_ECTSI) HSP 1 Score: 100 bits (249), Expect = 1.790e-24 Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 0 Query: 66 HDAAVDATKLVDTNRTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVFPGDVDPELRPIK 128 +D V +T+++ R V+V WDDGH S +D+TWLRVNCPSFLHESGQRTVFPGDVDP L+P++ Sbjct: 76 NDPKVSSTQVLANERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTVFPGDVDPGLKPVE 138
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: A0A6H5KBM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBM7_9PHAE) HSP 1 Score: 100 bits (248), Expect = 4.350e-22 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 0 Query: 66 HDAAVDATKLVDTNRTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVFPGDVDPELRPIK 128 +D V +T+++ + R V+V WDDGH S +D+TWLRVNCPSFLHESGQRT+FPGDVDP L+P++ Sbjct: 74 NDPKVSSTEVLPSERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTLFPGDVDPGLKPVE 136
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: A0A1Z9SNZ8_9PROT (Gamma-butyrobetaine hydroxylase (Fragment) n=1 Tax=Pelagibacteraceae bacterium TMED258 TaxID=1986820 RepID=A0A1Z9SNZ8_9PROT) HSP 1 Score: 52.8 bits (125), Expect = 8.410e-6 Identity = 18/37 (48.65%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 80 RTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVF 116 R++Q+ W DG+TS+Y+F WLR NCPS +H + + F Sbjct: 15 RSIQIEWSDGNTSDYNFLWLRDNCPSEIHPTARERTF 51 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig9687.28475.1 ID=prot_D-dudresnayi_contig9687.28475.1|Name=mRNA_D-dudresnayi_contig9687.28475.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=128bpback to top |