mRNA_D-dudresnayi_contig10182.223.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: A0A6H5JIG8_9PHAE (Nudix hydrolase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIG8_9PHAE) HSP 1 Score: 92.0 bits (227), Expect = 1.560e-19 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 1 Query: 130 TAVIQFYSNHETDDPRFQGFGVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHMLEK 318 TAVIQF+S E RF+GFGV+KEDK ED+ T+V+SFTAPALAAALRDRET LH CAH+LE+ Sbjct: 252 TAVIQFHSLKEAALRRFEGFGVIKEDKAEDIHTLVESFTAPALAAALRDRETALHMCAHLLEQ 314
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: D7FSP6_ECTSI (Nudix hydrolase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSP6_ECTSI) HSP 1 Score: 90.1 bits (222), Expect = 7.540e-19 Identity = 44/63 (69.84%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 130 TAVIQFYSNHETDDPRFQGFGVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHMLEK 318 TAVIQF+S E RF+G GV+KEDK ED+ T+V+SFTAPALAAALRDRET LH CAH+LE+ Sbjct: 262 TAVIQFHSLQEAALRRFEGLGVIKEDKAEDIHTLVESFTAPALAAALRDRETALHMCAHLLEQ 324
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: A0A7S3Y7X1_9EUKA (Hypothetical protein n=2 Tax=Lotharella globosa TaxID=91324 RepID=A0A7S3Y7X1_9EUKA) HSP 1 Score: 66.6 bits (161), Expect = 1.280e-10 Identity = 31/46 (67.39%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 181 QGFGVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHMLEK 318 +G+GV+ EDK DL+ +VD+FTAPALAAALRDRE TLH CA +LE+ Sbjct: 107 KGYGVIHEDKARDLKHLVDNFTAPALAAALRDREETLHICATLLEE 152
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: A0A7S0DGZ8_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Amorphochlora amoebiformis TaxID=1561963 RepID=A0A7S0DGZ8_9EUKA) HSP 1 Score: 65.1 bits (157), Expect = 3.390e-10 Identity = 31/46 (67.39%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 181 QGFGVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHMLEK 318 +G+GVV EDK DL+ +VD+FTAPALAAALRDRE TLH C+ +LE+ Sbjct: 102 KGYGVVFEDKRRDLKHLVDNFTAPALAAALRDREETLHICSTLLEE 147
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: A0A7S2MRL7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2MRL7_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 9.910e-6 Identity = 22/41 (53.66%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 190 GVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHML 312 GV++ED +ED++ +V+++T PALA+ALRDRE L CA++L Sbjct: 34 GVLREDPVEDMRLLVENYTVPALASALRDREEILQLCANLL 74
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Match: A0A7S4IQK5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4IQK5_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 8.600e-5 Identity = 22/43 (51.16%), Postives = 32/43 (74.42%), Query Frame = 1 Query: 190 GVVKEDKMEDLQTMVDSFTAPALAAALRDRETTLHSCAHMLEK 318 GVV+ D ED++ M++++T PALA+ALRDRE L CA +L + Sbjct: 158 GVVRTDPGEDMRMMIENYTVPALASALRDREDVLQQCASLLAR 200 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10182.223.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10182.223.1 >prot_D-dudresnayi_contig10182.223.1 ID=prot_D-dudresnayi_contig10182.223.1|Name=mRNA_D-dudresnayi_contig10182.223.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=106bp MVILYIFFVLEHEWVEEEEEMAAAWLGGKEKQKEEEEEEEDEDTAVIQFYback to top mRNA from alignment at D-dudresnayi_contig10182:8487..9874- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10182.223.1 ID=mRNA_D-dudresnayi_contig10182.223.1|Name=mRNA_D-dudresnayi_contig10182.223.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=1388bp|location=Sequence derived from alignment at D-dudresnayi_contig10182:8487..9874- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10182:8487..9874- >mRNA_D-dudresnayi_contig10182.223.1 ID=mRNA_D-dudresnayi_contig10182.223.1|Name=mRNA_D-dudresnayi_contig10182.223.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=636bp|location=Sequence derived from alignment at D-dudresnayi_contig10182:8487..9874- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |