prot_D-dudresnayi_contig1058.660.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Match: A0A7S3H4P0_9STRA (Hypothetical protein (Fragment) n=2 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H4P0_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 4.480e-8 Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 0 Query: 1 GKSVAIVIQVICAALVVTMIIHLVNLYEMVYAHTTNIFGLIKLFLLKFSVGIIVLEGLICNFLINSGKTPYSSDDGDDTYDSAEK 85 GKS + + A++ +I LVN+YE V+ H N++G++KL LLK +VG+IV++GLI + L +G Y SDD TY +K Sbjct: 156 GKSAYVFFNALSTAVLFYGVICLVNVYEKVHEHCINLYGVLKLVLLKATVGLIVVQGLIESILYRNGSVTYESDD---TYSGEQK 237
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Match: A0A482SC88_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SC88_9ARCH) HSP 1 Score: 48.1 bits (113), Expect = 6.030e-5 Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 0 Query: 29 MVYAHTTNIFGLIKLFLLKFSVGIIVLEGLICNFLINSGKTPYSSD 74 M+Y++ +N+F + K+ +LK S+ +IVLEGLI F++ G +PY D Sbjct: 1 MIYSNCSNVFNVYKVMMLKLSITVIVLEGLIAEFMVRFGGSPYDDD 46 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig1058.660.1 ID=prot_D-dudresnayi_contig1058.660.1|Name=mRNA_D-dudresnayi_contig1058.660.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=86bpback to top |