prot_D-dudresnayi_contig10444.483.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10444.483.1 vs. uniprot
Match: A0A6H5JPS1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPS1_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 4.610e-7 Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 0 Query: 53 FCNSIGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 87 +CNSIGCP YTP+P AW+V C+D C QCC A Sbjct: 7 YCNSIGCPGGYTPIPNAWEVECDDDPCEVSQCCEA 41
BLAST of mRNA_D-dudresnayi_contig10444.483.1 vs. uniprot
Match: D7G5E9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5E9_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 3.260e-5 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 0 Query: 53 FCNSIGCPNNYTPVPEAWKVRCEDGRCTEEQCCLA 87 +CNSIGCP YTP+P AW+V C D C QCC A Sbjct: 128 YCNSIGCPGGYTPIPNAWEVECYDDSCEVSQCCEA 162 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10444.483.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10444.483.1 ID=prot_D-dudresnayi_contig10444.483.1|Name=mRNA_D-dudresnayi_contig10444.483.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=620bpback to top |