prot_D-dudresnayi_contig10429.465.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10429.465.1 vs. uniprot
Match: A0A6H5KT61_9PHAE (Hira domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KT61_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 2.680e-15 Identity = 45/71 (63.38%), Postives = 54/71 (76.06%), Query Frame = 0 Query: 19 GEILGLRLGSAPSVLGLNKLHLLKEVVLPALSSNRGLQRLVSEYYDTIE-VSSSGTMMAPPPARPRIVQQQ 88 GE+ GLRL + PS+LGL+KLHLL +VVLPALS NR LQRLVSEYYD +E VS S PPPA P ++Q+ Sbjct: 1055 GELPGLRLCNGPSILGLDKLHLLSKVVLPALSGNRSLQRLVSEYYDNLEYVSKSRRQQLPPPAPPSPLEQR 1125 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10429.465.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10429.465.1 ID=prot_D-dudresnayi_contig10429.465.1|Name=mRNA_D-dudresnayi_contig10429.465.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=169bpback to top |