prot_D-dudresnayi_contig104.426.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig104.426.1 vs. uniprot
Match: A0A7S3HPN4_9STRA (Protein transport protein sec16 (Fragment) n=2 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HPN4_9STRA) HSP 1 Score: 103 bits (258), Expect = 6.980e-24 Identity = 50/82 (60.98%), Postives = 61/82 (74.39%), Query Frame = 0 Query: 5 TLLYANQGSAAVLGTDKPAVRDEVLTLWRHNLAAILSNKGANWQQLAAFLGYRLQNEAKDLYAAHAAYLCAGVYPTFPTSSA 86 T + T+ P+ ++VLTLWRHNL+AILSNK NWQQLA+FLGYRLQ E+KD++AAH+AYL AG YPTFP SSA Sbjct: 705 TTTVTTSAHTTITNTNGPS--NDVLTLWRHNLSAILSNKPNNWQQLASFLGYRLQQESKDIFAAHSAYLTAGAYPTFPVSSA 784 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig104.426.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig104.426.1 ID=prot_D-dudresnayi_contig104.426.1|Name=mRNA_D-dudresnayi_contig104.426.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=94bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|