prot_D-dudresnayi_contig1034.361.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig1034.361.1 vs. uniprot
Match: A0A6H5KCM2_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCM2_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 4.890e-13 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 0 Query: 45 LRGSCDFCTKRKRRCDGDGVNRCSFCVAKNQPECHYSYRLPTGPR 89 +R SCDFC RK+RCDGDGVNRCS+C+ K P C YS R P PR Sbjct: 45 IRKSCDFCNGRKKRCDGDGVNRCSYCIIKKNPHCIYSPRRPQKPR 89
BLAST of mRNA_D-dudresnayi_contig1034.361.1 vs. uniprot
Match: A0A6H5K678_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K678_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 1.660e-10 Identity = 38/91 (41.76%), Postives = 48/91 (52.75%), Query Frame = 0 Query: 2 ENGSTSGPLGVQKQQHPRIDFIPTAAVSVSAGGNASSAPPGRR-----LRGSCDFCTKRKRRCDGDGVNRCSFCVAKNQPECHYSYR-LPT 86 +N + P +Q HP A S+ GN S R L+ SCDFC KR++RCDG RCSFC+ K +PECHYS R LP+ Sbjct: 55 DNTPMNKPETRHRQHHP---MNKPAERGPSSTGNVPSKERRRHPQTIVLKKSCDFCFKRRKRCDGRAQRRCSFCIEKGRPECHYSMRSLPS 142
BLAST of mRNA_D-dudresnayi_contig1034.361.1 vs. uniprot
Match: D7FTE0_ECTSI (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTE0_ECTSI) HSP 1 Score: 52.4 bits (124), Expect = 2.220e-5 Identity = 30/73 (41.10%), Postives = 38/73 (52.05%), Query Frame = 0 Query: 11 GVQKQQHPRIDFIPTAAVSVSAGGNASSAPPGRRLRGSCDFCTKRKRRCDGDGVNRCSFCVAKNQPECHYSYR 83 G+Q+Q TA + +A +APP R+ SC FC KRKR CD RCS C+ K QP CHY + Sbjct: 24 GMQRQPQSAGQPAYTATPAEAA---VEAAPP-RQTYKSCTFCAKRKRACDSQRP-RCSLCIEKKQPYCHYPLK 91
BLAST of mRNA_D-dudresnayi_contig1034.361.1 vs. uniprot
Match: A0A6H5L0W7_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0W7_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 4.130e-5 Identity = 26/58 (44.83%), Postives = 32/58 (55.17%), Query Frame = 0 Query: 26 AAVSVSAGGNASSAPPGRRLRGSCDFCTKRKRRCDGDGVNRCSFCVAKNQPECHYSYR 83 A ++ A + +A P R SC FC KRKR CD RCS C+ KNQP CHY + Sbjct: 36 AYMATPAEASVEAALP-RHTYKSCTFCAKRKRSCDSRRP-RCSLCIEKNQPHCHYPLK 91 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig1034.361.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig1034.361.1 ID=prot_D-dudresnayi_contig1034.361.1|Name=mRNA_D-dudresnayi_contig1034.361.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=120bpback to top |