prot_D-dudresnayi_contig10307.334.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A482SE92_9ARCH (Cytochrome P450 n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SE92_9ARCH) HSP 1 Score: 75.9 bits (185), Expect = 7.340e-15 Identity = 32/46 (69.57%), Postives = 39/46 (84.78%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTKI 46 +QVKTI+S+L R +K EAID E PEPDYTAMVVGPK HC V+YT++ Sbjct: 429 LQVKTILSILFRNFKLEAIDNELPEPDYTAMVVGPKGHCRVKYTRL 474
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A7S3E0X5_9CHLO (Hypothetical protein n=1 Tax=Chloropicon laureae TaxID=464258 RepID=A0A7S3E0X5_9CHLO) HSP 1 Score: 62.4 bits (150), Expect = 2.410e-10 Identity = 31/49 (63.27%), Postives = 36/49 (73.47%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDK--EFPEPDYTAMVVGPKNHCMVRYTKIK 47 MQVK I+S+LLR + FE + E PEPDYTAMVVGPK C V+YTK K Sbjct: 203 MQVKIIMSILLRKFDFELLSNGGEIPEPDYTAMVVGPKPPCKVKYTKKK 251
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A835YR70_9STRA (Obtusifoliol 14alpha-demethylase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR70_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 2.720e-9 Identity = 26/45 (57.78%), Postives = 37/45 (82.22%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 +QVKT+VS+LLR ++FE I+K+ PE +Y +MVVGPK + MVRY + Sbjct: 438 LQVKTLVSILLRNFEFELIEKKMPELNYESMVVGPKGNIMVRYKR 482
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A7S3U9T7_9CHLO (Hypothetical protein n=1 Tax=Picocystis salinarum TaxID=88271 RepID=A0A7S3U9T7_9CHLO) HSP 1 Score: 59.7 bits (143), Expect = 3.720e-9 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 +Q+KTI S+LLR + FE FPEPDY AMVVGPK C VRY + Sbjct: 449 LQIKTIWSILLRKFDFEFAQDHFPEPDYEAMVVGPKPPCRVRYKR 493
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: D8LQM6_ECTSI (Obtusifoliol 14alpha-Demethylase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQM6_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 2.430e-8 Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 +QVKTI+S+LLR YK E + E P D+ AMVVGPK C VRYTK Sbjct: 444 VQVKTILSVLLREYKIEMVG-ELPPADFNAMVVGPKGKCTVRYTK 487
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A8J2SKN8_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2SKN8_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 2.430e-8 Identity = 29/44 (65.91%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 2 QVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 QVKTI+S L R Y E + EFPEPDYTAMVVGPK MVRY + Sbjct: 450 QVKTILSWLNRNYDMEIVS-EFPEPDYTAMVVGPKGKPMVRYVR 492
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A6S9L9Q6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6S9L9Q6_HETAK) HSP 1 Score: 56.2 bits (134), Expect = 6.140e-8 Identity = 30/48 (62.50%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNH-CMVRYTKIK 47 MQVKTI+++LLR Y E + FPEPDYTAMVVGPK C VRY++ K Sbjct: 322 MQVKTIMTVLLRRYDLE-LAGPFPEPDYTAMVVGPKEGTCKVRYSRRK 368
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A820QML4_9BILA (Hypothetical protein n=8 Tax=Rotaria TaxID=231623 RepID=A0A820QML4_9BILA) HSP 1 Score: 54.7 bits (130), Expect = 2.180e-7 Identity = 25/45 (55.56%), Postives = 36/45 (80.00%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 +QVKTI S+LLR + FE + +E PEPDY+A+VVGPK C+V++ + Sbjct: 441 LQVKTIWSILLRKFDFE-LCQEHPEPDYSALVVGPKGPCIVKFKR 484
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: A0A5B8MG96_9CHLO (Cytochrome P450 sterol 14-demethylase n=1 Tax=Chloropicon primus TaxID=1764295 RepID=A0A5B8MG96_9CHLO) HSP 1 Score: 54.7 bits (130), Expect = 2.180e-7 Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKE--FPEPDYTAMVVGPKNHCMVRYTKIK 47 MQVK ++S+LLR + FE + PEP+Y AMVVGP+ C VR+TK K Sbjct: 457 MQVKVLMSVLLRKFDFELLSNNGAIPEPNYDAMVVGPRQPCKVRFTKKK 505
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Match: B7GEJ8_PHATC (Predicted protein n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=B7GEJ8_PHATC) HSP 1 Score: 53.9 bits (128), Expect = 4.070e-7 Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 1 MQVKTIVSLLLRTYKFEAIDKEFPEPDYTAMVVGPKNHCMVRYTK 45 +QVKTI+S+LLR Y+ E ++ P+ Y MVVGPK C VRY K Sbjct: 434 LQVKTIISVLLREYELERVEPGMPDIGYDDMVVGPKGDCTVRYRK 478 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10307.334.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 21
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10307.334.1 ID=prot_D-dudresnayi_contig10307.334.1|Name=mRNA_D-dudresnayi_contig10307.334.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=48bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|