prot_D-dudresnayi_contig10126.164.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10126.164.1 vs. uniprot
Match: D7G174_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G174_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 8.710e-5 Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 0 Query: 30 RITMRDQLPPGWETTVRERAENDVDARGQGAFWY--SFSKGGN--TVRFRSLKDVENFVNSDHPDAAQHRNAARKRK 102 RI+ LPPGWE ++ E + G WY + KG N ++F++L+DVE+FV+SD P A HR A KRK Sbjct: 873 RISSSSNLPPGWEIIRSKQPEKN---NGYACRWYVYKYGKGSNLPNLKFKNLRDVEDFVHSDLPGAKIHRRAMEKRK 946 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10126.164.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10126.164.1 ID=prot_D-dudresnayi_contig10126.164.1|Name=mRNA_D-dudresnayi_contig10126.164.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=351bpback to top |