prot_D-dudresnayi_contig10000.37.1 (polypeptide) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10000.37.1 vs. uniprot
Match: A0A6H5JZK9_9PHAE (AAA domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZK9_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 7.810e-9 Identity = 33/41 (80.49%), Postives = 38/41 (92.68%), Query Frame = 0 Query: 41 QMDIERVQAEVQAKVAAEADNEDMVLRKIRAQGEEDRRRTQ 81 QMD+ERVQAEV+AK AAE NED++LRKI+AQGEEDRRRTQ Sbjct: 12 QMDMERVQAEVEAKFAAEQQNEDVMLRKIKAQGEEDRRRTQ 52
BLAST of mRNA_D-dudresnayi_contig10000.37.1 vs. uniprot
Match: D8LE55_ECTSI (AAA domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LE55_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 1.580e-6 Identity = 29/44 (65.91%), Postives = 38/44 (86.36%), Query Frame = 0 Query: 29 MEIERAMDTEKLQMDIERVQAEVQAKVAAEADNEDMVLRKIRAQ 72 M++E+ M+ +K QMDIERVQAEV+AK AAE NED++LRKI+AQ Sbjct: 1 MDLEQEMEAQKRQMDIERVQAEVEAKFAAEQQNEDVMLRKIQAQ 44 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10000.37.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_D-dudresnayi_contig10000.37.1 ID=prot_D-dudresnayi_contig10000.37.1|Name=mRNA_D-dudresnayi_contig10000.37.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=81bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|