mRNA_D-dudresnayi_contig9687.28475.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: D7FYZ2_ECTSI (GBBH-like_N domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYZ2_ECTSI) HSP 1 Score: 100 bits (249), Expect = 1.240e-23 Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 2 Query: 374 HDAAVDATKLVDTNRTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVFPGDVDPELRPIK 562 +D V +T+++ R V+V WDDGH S +D+TWLRVNCPSFLHESGQRTVFPGDVDP L+P++ Sbjct: 76 NDPKVSSTQVLANERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTVFPGDVDPGLKPVE 138
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: A0A6H5KBM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBM7_9PHAE) HSP 1 Score: 100 bits (248), Expect = 3.100e-21 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 2 Query: 374 HDAAVDATKLVDTNRTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVFPGDVDPELRPIK 562 +D V +T+++ + R V+V WDDGH S +D+TWLRVNCPSFLHESGQRT+FPGDVDP L+P++ Sbjct: 74 NDPKVSSTEVLPSERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTLFPGDVDPGLKPVE 136
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Match: A0A1Z9SNZ8_9PROT (Gamma-butyrobetaine hydroxylase (Fragment) n=1 Tax=Pelagibacteraceae bacterium TMED258 TaxID=1986820 RepID=A0A1Z9SNZ8_9PROT) HSP 1 Score: 52.8 bits (125), Expect = 3.140e-5 Identity = 18/37 (48.65%), Postives = 27/37 (72.97%), Query Frame = 2 Query: 416 RTVQVHWDDGHTSNYDFTWLRVNCPSFLHESGQRTVF 526 R++Q+ W DG+TS+Y+F WLR NCPS +H + + F Sbjct: 15 RSIQIEWSDGNTSDYNFLWLRDNCPSEIHPTARERTF 51 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig9687.28475.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig9687.28475.1 >prot_D-dudresnayi_contig9687.28475.1 ID=prot_D-dudresnayi_contig9687.28475.1|Name=mRNA_D-dudresnayi_contig9687.28475.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=128bp MCYSIIRSYMPATRRLALWPARYLSASKVGLPQATAALLRSTINGRPAPFback to top mRNA from alignment at D-dudresnayi_contig9687:10547..11108+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig9687.28475.1 ID=mRNA_D-dudresnayi_contig9687.28475.1|Name=mRNA_D-dudresnayi_contig9687.28475.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=562bp|location=Sequence derived from alignment at D-dudresnayi_contig9687:10547..11108+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig9687:10547..11108+ >mRNA_D-dudresnayi_contig9687.28475.1 ID=mRNA_D-dudresnayi_contig9687.28475.1|Name=mRNA_D-dudresnayi_contig9687.28475.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=768bp|location=Sequence derived from alignment at D-dudresnayi_contig9687:10547..11108+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |