mRNA_D-dudresnayi_contig1058.660.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Match: A0A7S3H4P0_9STRA (Hypothetical protein (Fragment) n=2 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H4P0_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 4.480e-8 Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 1 Query: 1 GKSVAIVIQVICAALVVTMIIHLVNLYEMVYAHTTNIFGLIKLFLLKFSVGIIVLEGLICNFLINSGKTPYSSDDGDDTYDSAEK 255 GKS + + A++ +I LVN+YE V+ H N++G++KL LLK +VG+IV++GLI + L +G Y SDD TY +K Sbjct: 156 GKSAYVFFNALSTAVLFYGVICLVNVYEKVHEHCINLYGVLKLVLLKATVGLIVVQGLIESILYRNGSVTYESDD---TYSGEQK 237
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Match: A0A482SC88_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SC88_9ARCH) HSP 1 Score: 48.1 bits (113), Expect = 6.030e-5 Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 85 MVYAHTTNIFGLIKLFLLKFSVGIIVLEGLICNFLINSGKTPYSSD 222 M+Y++ +N+F + K+ +LK S+ +IVLEGLI F++ G +PY D Sbjct: 1 MIYSNCSNVFNVYKVMMLKLSITVIVLEGLIAEFMVRFGGSPYDDD 46 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig1058.660.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig1058.660.1 >prot_D-dudresnayi_contig1058.660.1 ID=prot_D-dudresnayi_contig1058.660.1|Name=mRNA_D-dudresnayi_contig1058.660.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=86bp GKSVAIVIQVICAALVVTMIIHLVNLYEMVYAHTTNIFGLIKLFLLKFSVback to top mRNA from alignment at D-dudresnayi_contig1058:27647..27967+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig1058.660.1 ID=mRNA_D-dudresnayi_contig1058.660.1|Name=mRNA_D-dudresnayi_contig1058.660.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=321bp|location=Sequence derived from alignment at D-dudresnayi_contig1058:27647..27967+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig1058:27647..27967+ >mRNA_D-dudresnayi_contig1058.660.1 ID=mRNA_D-dudresnayi_contig1058.660.1|Name=mRNA_D-dudresnayi_contig1058.660.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=516bp|location=Sequence derived from alignment at D-dudresnayi_contig1058:27647..27967+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |