mRNA_D-dudresnayi_contig10273.310.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A6H5JFY8_9PHAE (DUF1995 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JFY8_9PHAE) HSP 1 Score: 108 bits (270), Expect = 5.600e-27 Identity = 46/50 (92.00%), Postives = 50/50 (100.00%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGWIFRKAPEDWQV 150 +LRGGYYPRIF+PGLYNAKERFLKKFET+YYLKALPGGWIFR+APEDWQV Sbjct: 280 KLRGGYYPRIFFPGLYNAKERFLKKFETVYYLKALPGGWIFRRAPEDWQV 329
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A836CP02_9STRA (DUF1995 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CP02_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 7.890e-20 Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGWIFRKAPEDWQV 150 ++RGGYYP++ YPGL+ AK+RF+K FE +YYLKALP GW+FR+ PEDWQV Sbjct: 130 KVRGGYYPKLVYPGLHAAKDRFIKNFEPVYYLKALPEGWLFRRYPEDWQV 179
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: W7TLD5_9STRA (DUF1995 domain-containing protein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TLD5_9STRA) HSP 1 Score: 83.6 bits (205), Expect = 7.330e-18 Identity = 35/49 (71.43%), Postives = 41/49 (83.67%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGWIFRKAPEDWQ 147 ++RGGYYPRIFYPGLYN KER L+ FE +YYLK GG+IFRK PE+WQ Sbjct: 206 RIRGGYYPRIFYPGLYNVKERMLQYFEPVYYLKPAQGGFIFRKFPEEWQ 254
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A4D9D5M4_9STRA (DUF1995 domain-containing protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D5M4_9STRA) HSP 1 Score: 80.5 bits (197), Expect = 3.250e-17 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGWIFRKAPEDWQ 147 ++RGGYYPRIFYPGLY KER L+ FE +YYLK GG++FRK PE+WQ Sbjct: 117 RIRGGYYPRIFYPGLYKVKERMLQYFEPVYYLKPAQGGFLFRKFPEEWQ 165
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A7S1TG32_9RHOD (Hypothetical protein (Fragment) n=1 Tax=Compsopogon caeruleus TaxID=31354 RepID=A0A7S1TG32_9RHOD) HSP 1 Score: 67.8 bits (164), Expect = 1.900e-13 Identity = 28/51 (54.90%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALP-GGWIFRKAPEDWQV 150 ++RG YYP++FYPGL+ ++RFL +FE IYYLK GG++FR PE WQ+ Sbjct: 24 KVRGSYYPKLFYPGLHKVRDRFLCRFEPIYYLKPFSSGGYLFRAYPEPWQL 74
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A7S0ZAT4_9RHOD (Hypothetical protein n=2 Tax=Timspurckia oligopyrenoides TaxID=708627 RepID=A0A7S0ZAT4_9RHOD) HSP 1 Score: 69.7 bits (169), Expect = 9.220e-13 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGW--IFRKAPEDWQV 150 ++RGGYYPRIFYPGL+ K+RFL KFE I++LK G +FRK PE WQ Sbjct: 224 RVRGGYYPRIFYPGLHRVKDRFLNKFEPIFFLKQFGSGLGVLFRKYPEPWQT 275
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A2V3IVF9_9FLOR (DUF1995 domain-containing protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IVF9_9FLOR) HSP 1 Score: 67.8 bits (164), Expect = 1.860e-12 Identity = 27/51 (52.94%), Postives = 41/51 (80.39%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALP-GGWIFRKAPEDWQV 150 ++RGGYYPR+FYPGL+ A+++ LK+FE IYY+K+ GG + R+ PE W++ Sbjct: 131 KVRGGYYPRLFYPGLHKARDKVLKRFEEIYYIKSFSNGGTLLRRFPEGWKL 181
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A5J4Z109_PORPP (Protein LOW PSII ACCUMULATION 3, chloroplastic n=1 Tax=Porphyridium purpureum TaxID=35688 RepID=A0A5J4Z109_PORPP) HSP 1 Score: 59.3 bits (142), Expect = 5.250e-9 Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGW--IFRKAPEDWQV 150 ++R GYYPR+FYP L+ K+RFL KFE +++ K G ++RK P DWQ Sbjct: 213 RVRSGYYPRLFYPKLHQTKDRFLCKFEPVFFYKPFGSGLGTLYRKFPADWQT 264
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Match: A0A7S0G1A8_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S0G1A8_9RHOD) HSP 1 Score: 57.4 bits (137), Expect = 1.510e-8 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 1 QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPG-GWIFRKAPEDWQV 150 ++RGGYYPRIFYP L+ ER L+KF +IY+ K+ P G + R P W++ Sbjct: 122 RIRGGYYPRIFYPKLHKVAERSLRKFVSIYFFKSYPNRGTLLRAYPGPWRL 172 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10273.310.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10273.310.1 >prot_D-dudresnayi_contig10273.310.1 ID=prot_D-dudresnayi_contig10273.310.1|Name=mRNA_D-dudresnayi_contig10273.310.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=52bp QLRGGYYPRIFYPGLYNAKERFLKKFETIYYLKALPGGWIFRKAPEDWQVback to top mRNA from alignment at D-dudresnayi_contig10273:143..298+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10273.310.1 ID=mRNA_D-dudresnayi_contig10273.310.1|Name=mRNA_D-dudresnayi_contig10273.310.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=156bp|location=Sequence derived from alignment at D-dudresnayi_contig10273:143..298+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10273:143..298+ >mRNA_D-dudresnayi_contig10273.310.1 ID=mRNA_D-dudresnayi_contig10273.310.1|Name=mRNA_D-dudresnayi_contig10273.310.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=312bp|location=Sequence derived from alignment at D-dudresnayi_contig10273:143..298+ (Desmarestia dudresnayi DdudBR16 monoicous)back to top |