mRNA_D-dudresnayi_contig1026.301.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig1026.301.1 vs. uniprot
Match: A0A6H5KE74_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KE74_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 9.880e-11 Identity = 41/95 (43.16%), Postives = 55/95 (57.89%), Query Frame = 1 Query: 1 LAQGLPLDKLDGVLATVTSKVDQAVQSLDETIHEIFGDQTEAGDGQHLHLADPSLGSSKTSNAAASRRVLKDGWVELHGGVPSQSPTLLDASQDA 285 LA G ++LD VLATV+SKVD+AVQSLDETI++IFGD + + + A+ S G+ +DGWVEL GG + LL + A Sbjct: 375 LANGNWNEQLDDVLATVSSKVDKAVQSLDETINDIFGDNDDVDNDDNKAKANSSGGT-------------RDGWVELRGGTAKSASALLHPEEAA 456
BLAST of mRNA_D-dudresnayi_contig1026.301.1 vs. uniprot
Match: D8LHU4_ECTSI (Rap2 interacting protein x isoform 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHU4_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 5.000e-8 Identity = 38/89 (42.70%), Postives = 46/89 (51.69%), Query Frame = 1 Query: 1 LAQGLPLDKLDGVLATVTSKVDQAVQSLDETIHEIFGDQTEAGDGQHLHLADPSLGSSKTSNAAASRRVLKDGWVELHGGVPSQSPTLL 267 LA G ++LD VLATV+SKVD+AVQSLDETI +IFGD G+ +DGWVEL GG + LL Sbjct: 350 LANGNWNEQLDDVLATVSSKVDKAVQSLDETIQDIFGDDXXXXXXXXXXXXXXXGGT-------------RDGWVELRGGTAKSASALL 425 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig1026.301.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig1026.301.1 >prot_D-dudresnayi_contig1026.301.1 ID=prot_D-dudresnayi_contig1026.301.1|Name=mRNA_D-dudresnayi_contig1026.301.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=104bp LAQGLPLDKLDGVLATVTSKVDQAVQSLDETIHEIFGDQTEAGDGQHLHLback to top mRNA from alignment at D-dudresnayi_contig1026:24378..25834- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig1026.301.1 ID=mRNA_D-dudresnayi_contig1026.301.1|Name=mRNA_D-dudresnayi_contig1026.301.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=1457bp|location=Sequence derived from alignment at D-dudresnayi_contig1026:24378..25834- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig1026:24378..25834- >mRNA_D-dudresnayi_contig1026.301.1 ID=mRNA_D-dudresnayi_contig1026.301.1|Name=mRNA_D-dudresnayi_contig1026.301.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=624bp|location=Sequence derived from alignment at D-dudresnayi_contig1026:24378..25834- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |