mRNA_D-dudresnayi_contig10.25.1 (mRNA) Desmarestia dudresnayi DdudBR16 monoicous
Overview
Homology
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A482UWH2_9ARCH (Biotin carboxylation domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482UWH2_9ARCH) HSP 1 Score: 103 bits (256), Expect = 6.490e-27 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 1 Query: 49 SRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 SRVYAE+P R FLPSIGPLITYKEP +D G +RIDTGV+EGG IS +YDPMI+KLCTWAPTR Sbjct: 2 SRVYAEEPRRNFLPSIGPLITYKEPRTFTSDE--GVLRIDTGVYEGGVISPFYDPMIAKLCTWAPTR 66
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A5S3PBD3_9RHOB (Propionyl-CoA carboxylase n=1 Tax=Sulfitobacter sabulilitoris TaxID=2562655 RepID=A0A5S3PBD3_9RHOB) HSP 1 Score: 106 bits (264), Expect = 6.910e-25 Identity = 53/73 (72.60%), Postives = 59/73 (80.82%), Query Frame = 1 Query: 31 KGSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 KG AIE+R+YAEDP RGFLPSIG L Y+ P +V +D I VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 331 KGWAIENRLYAEDPYRGFLPSIGRLTRYRPPAEVGSDHAI--VRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A7G3CYE8_9RHOB (Propionyl-CoA carboxylase n=1 Tax=Carideicomes alvinocaridis TaxID=2541728 RepID=A0A7G3CYE8_9RHOB) HSP 1 Score: 106 bits (264), Expect = 6.910e-25 Identity = 53/77 (68.83%), Postives = 60/77 (77.92%), Query Frame = 1 Query: 19 HLTAKGSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 +LT G AIE+R+YAEDP RGFLPSIG L Y+ P +V D + VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 327 NLTINGWAIENRLYAEDPYRGFLPSIGRLTRYRPPEEVSLDTHV--VRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A1H9EGI5_9RHOB (Propionyl-CoA carboxylase n=1 Tax=Thalassobius taeanensis TaxID=657014 RepID=A0A1H9EGI5_9RHOB) HSP 1 Score: 106 bits (264), Expect = 6.910e-25 Identity = 52/72 (72.22%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 34 GSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 G A+ESR+YAEDP RGFLPSIG L Y+ P +VV D + VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 332 GWAMESRLYAEDPYRGFLPSIGRLSRYRPPAEVVEDNRV--VRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A345QQ84_9RHOB (Propionyl-CoA carboxylase n=1 Tax=Sulfitobacter sp. SK012 TaxID=1389005 RepID=A0A345QQ84_9RHOB) HSP 1 Score: 105 bits (263), Expect = 9.440e-25 Identity = 51/72 (70.83%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 34 GSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 G AIE+R+YAEDP RGFLPSIG L Y+ P +VV D + VR DTGV+EGG ISMYYDPMI+KLCTWAPTR Sbjct: 332 GWAIENRLYAEDPYRGFLPSIGRLTRYRPPAEVVEDTHV--VRNDTGVYEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A3T0N4A1_9RHOB (Propionyl-CoA carboxylase n=6 Tax=Rhodobacterales TaxID=204455 RepID=A0A3T0N4A1_9RHOB) HSP 1 Score: 105 bits (262), Expect = 1.290e-24 Identity = 52/72 (72.22%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 34 GSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 G AIE+R+YAEDP RGFLPSIG L Y+ P +VV + I VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 332 GWAIENRLYAEDPYRGFLPSIGRLSRYRPPAEVVEETHI--VRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A7C9L713_9RHOB (Propionyl-CoA carboxylase n=2 Tax=Sediminimonas qiaohouensis TaxID=552061 RepID=A0A7C9L713_9RHOB) HSP 1 Score: 105 bits (262), Expect = 1.290e-24 Identity = 52/76 (68.42%), Postives = 58/76 (76.32%), Query Frame = 1 Query: 22 LTAKGSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 + G AIESR+YAEDP RGFLPSIG L Y+ P + V+D VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 328 IALNGWAIESRLYAEDPYRGFLPSIGRLTRYRPPQETVSDT--AKVRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A357FGP8_9RHOB (Propionyl-CoA carboxylase n=5 Tax=Rhodobacterales TaxID=204455 RepID=A0A357FGP8_9RHOB) HSP 1 Score: 104 bits (260), Expect = 2.420e-24 Identity = 48/72 (66.67%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 34 GSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 G AIE+R+YAEDP RGFLPSIG L Y+ P+++ D + +R DTGVFEGG I+MYYDPMI+KLCTWAPTR Sbjct: 332 GWAIENRLYAEDPYRGFLPSIGRLTRYRPPIEIATDTHV--IRNDTGVFEGGEITMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A1I6YBX8_9RHOB (Propionyl-CoA carboxylase n=4 Tax=Rhodobacterales TaxID=204455 RepID=A0A1I6YBX8_9RHOB) HSP 1 Score: 104 bits (259), Expect = 3.290e-24 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 34 GSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 G AIE+R+YAEDP RGFLPSIG L Y+ P +V +D + VR DTGV+EGG ISMYYDPMI+KLCTWAPTR Sbjct: 332 GWAIENRLYAEDPYRGFLPSIGRLSRYRPPAEVADDSHV--VRNDTGVYEGGEISMYYDPMIAKLCTWAPTR 401
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Match: A0A2N3BN15_9PROT (Propionyl-CoA carboxylase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2N3BN15_9PROT) HSP 1 Score: 104 bits (259), Expect = 3.290e-24 Identity = 51/76 (67.11%), Postives = 58/76 (76.32%), Query Frame = 1 Query: 22 LTAKGSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIGTVRIDTGVFEGGTISMYYDPMISKLCTWAPTR 249 L G A+ESR+YAEDP RGFLPSIG L Y+ P++ + G VR DTGVFEGG ISMYYDPMI+KLCTWAPTR Sbjct: 328 LKINGWAMESRLYAEDPYRGFLPSIGRLTRYRPPVEAAH--ATGVVRNDTGVFEGGEISMYYDPMIAKLCTWAPTR 401 The following BLAST results are available for this feature:
BLAST of mRNA_D-dudresnayi_contig10.25.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_D-dudresnayi_contig10.25.1 >prot_D-dudresnayi_contig10.25.1 ID=prot_D-dudresnayi_contig10.25.1|Name=mRNA_D-dudresnayi_contig10.25.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=polypeptide|length=84bp RLTSAPHLTAKGSAIESRVYAEDPLRGFLPSIGPLITYKEPLQVVNDPEIback to top mRNA from alignment at D-dudresnayi_contig10:72341..72737- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_D-dudresnayi_contig10.25.1 ID=mRNA_D-dudresnayi_contig10.25.1|Name=mRNA_D-dudresnayi_contig10.25.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=mRNA|length=397bp|location=Sequence derived from alignment at D-dudresnayi_contig10:72341..72737- (Desmarestia dudresnayi DdudBR16 monoicous)back to top Coding sequence (CDS) from alignment at D-dudresnayi_contig10:72341..72737- >mRNA_D-dudresnayi_contig10.25.1 ID=mRNA_D-dudresnayi_contig10.25.1|Name=mRNA_D-dudresnayi_contig10.25.1|organism=Desmarestia dudresnayi DdudBR16 monoicous|type=CDS|length=504bp|location=Sequence derived from alignment at D-dudresnayi_contig10:72341..72737- (Desmarestia dudresnayi DdudBR16 monoicous)back to top |