prot_C-australica_Contig_9851.2.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_9851.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
EEFFAYFELISFWQNMEGIKNFAGDDHQRAKYYPDDKKYLIDFPEEVTHFEIFAEE*510152025303540455055Expect = 7.14e-29 / Id = 83.93Expect = 2.38e-27 / Id = 80.36Expect = 5.56e-23 / Id = 71.15Expect = 1.64e-22 / Id = 71.70Expect = 3.30e-22 / Id = 71.70Expect = 1.85e-21 / Id = 71.15Expect = 1.85e-21 / Id = 63.64Expect = 5.30e-21 / Id = 67.31Expect = 5.44e-21 / Id = 64.15Expect = 7.73e-21 / Id = 67.31SequenceA0A350PLX3_9BACTA0A1B6Y5U7_9BACTUPI0014313598A0A653TY29_9FLAOUPI000C0719F6A0A316LCP0_9FLAOA0A5C8UZI1_9FLAOA0A2G2HLI1_9FLAOA0A2T0MJY1_9FLAOA0A4Q8Q9E3_9FLAO
Match NameE-valueIdentityDescription
A0A350PLX3_9BACT7.140e-2983.93Antibiotic biosynthesis monooxygenase n=3 Tax=Baln... [more]
A0A1B6Y5U7_9BACT2.380e-2780.36ABM domain-containing protein n=1 Tax=Balneola sp.... [more]
UPI00143135985.560e-2371.15antibiotic biosynthesis monooxygenase n=1 Tax=Gaet... [more]
A0A653TY29_9FLAO1.640e-2271.70Antibiotic biosynthesis monooxygenase n=2 Tax=Mari... [more]
UPI000C0719F63.300e-2271.70antibiotic biosynthesis monooxygenase n=4 Tax=Mari... [more]
A0A316LCP0_9FLAO1.850e-2171.15Antibiotic biosynthesis monooxygenase n=1 Tax=Muri... [more]
A0A5C8UZI1_9FLAO1.850e-2163.64Antibiotic biosynthesis monooxygenase n=1 Tax=Flag... [more]
A0A2G2HLI1_9FLAO5.300e-2167.31Antibiotic biosynthesis monooxygenase n=1 Tax=Luti... [more]
A0A2T0MJY1_9FLAO5.440e-2164.15Uncharacterized protein n=1 Tax=Muricauda pacifica... [more]
A0A4Q8Q9E3_9FLAO7.730e-2167.31Antibiotic biosynthesis monooxygenase n=1 Tax=Muri... [more]

Pages

back to top