prot_C-australica_Contig_9849.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_9849.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 5
ZOOM
x 1
POSITION
0
GGTTRAIQQELVARGYLSDRDVDGAFGPTTRRALERLVAAAGR*510152025303540Expect = 1.14e-19 / Id = 100.00Expect = 2.91e-19 / Id = 97.67Expect = 8.21e-12 / Id = 80.49Expect = 6.52e-10 / Id = 73.17Expect = 1.67e-9 / Id = 70.73SequenceA0A222E6Y3_9RHOBA0A239FJH9_9RHOBUPI001C94780CA0A0B3SBX0_9RHOBUPI001C5E1E99
Match NameE-valueIdentityDescription
A0A222E6Y3_9RHOB1.140e-19100.00Serine protease n=2 Tax=Roseobacteraceae TaxID=285... [more]
A0A239FJH9_9RHOB2.910e-1997.67Serine protease n=1 Tax=Antarctobacter heliothermu... [more]
UPI001C94780C8.210e-1280.49trypsin-like peptidase domain-containing protein n... [more]
A0A0B3SBX0_9RHOB6.520e-1073.17Serine protease n=7 Tax=Roseobacteraceae TaxID=285... [more]
UPI001C5E1E991.670e-970.73trypsin-like peptidase domain-containing protein n... [more]
back to top