prot_C-australica_Contig_9820.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_9820.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MLFGWDRVGRGLHFLATVMVAVGTLLSTFWILSANSWMHTPAGFELRDGIFHPTDWWAIVFNPSFPYRLAHMVLAAYLTTAFVILGVAAWYLRRGMAPQGAKVMLAMGVGFIAITAPLQIVAGDFHGLNVQEHQPAKVAAMEGHWETRRGAPLYLFAVPDPENETNHYEIAIPKLGSLILAHDLDGEVLGLDAFPVEDRPPVIPVFYAFRVMVALGMLMLLAAAWGLWLWWRDRLFEPGWYHRFMVGMAPSGFVAVLAGWFTAEIGRQPWGVYCL20406080100120140160180200220240260Expect = 4.71e-137 / Id = 69.09Expect = 5.42e-136 / Id = 68.73Expect = 2.59e-124 / Id = 63.27Expect = 5.41e-123 / Id = 65.07Expect = 2.04e-122 / Id = 60.00Expect = 3.44e-121 / Id = 65.09Expect = 1.11e-120 / Id = 62.32Expect = 5.41e-120 / Id = 65.56Expect = 8.17e-120 / Id = 62.91Expect = 8.40e-120 / Id = 64.36SequenceU2ELN9_9GAMMA0A423PV48_9GAMMA0A2D6JYG8_9PROTA0A363UKP0_9GAMMA0A1H3DG30_9PSEDA0A4R6ZA98_9GAMMA0A7V8ZRZ9_9BURKA0A0P9CQ27_9GAMMUPI0019A5FDC0UPI000737CCED
Match NameE-valueIdentityDescription
U2ELN9_9GAMM4.710e-13769.09Cytochrome bd-I oxidase subunit I protein n=7 Tax=... [more]
A0A423PV48_9GAMM5.420e-13668.73Cytochrome D ubiquinol oxidase subunit I n=2 Tax=S... [more]
A0A2D6JYG8_9PROT2.590e-12463.27Cytochrome ubiquinol oxidase subunit I n=2 Tax=Bac... [more]
A0A363UKP0_9GAMM5.410e-12365.07Cytochrome ubiquinol oxidase subunit I n=2 Tax=Gam... [more]
A0A1H3DG30_9PSED2.040e-12260.00Cytochrome bd-I ubiquinol oxidase subunit 1 apopro... [more]
A0A4R6ZA98_9GAMM3.440e-12165.09Cytochrome bd-I ubiquinol oxidase subunit 1 apopro... [more]
A0A7V8ZRZ9_9BURK1.110e-12062.32Cytochrome ubiquinol oxidase subunit I n=1 Tax=Bur... [more]
A0A0P9CQ27_9GAMM5.410e-12065.56Cytochrome d ubiquinol oxidase subunit I n=1 Tax=T... [more]
UPI0019A5FDC08.170e-12062.91Cytochrome ubiquinol oxidase subunit I n=1 Tax=Can... [more]
UPI000737CCED8.400e-12064.36cytochrome ubiquinol oxidase subunit I n=1 Tax=Lut... [more]

Pages

back to top