prot_C-australica_Contig_10171.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
VNILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD*5101520253035404550Expect = 5.20e-28 / Id = 96.15Expect = 2.48e-26 / Id = 92.31Expect = 5.88e-25 / Id = 88.46Expect = 1.65e-24 / Id = 86.00Expect = 1.69e-24 / Id = 82.69Expect = 3.33e-24 / Id = 84.00Expect = 2.08e-23 / Id = 86.00Expect = 2.75e-23 / Id = 86.00Expect = 2.81e-23 / Id = 82.69Expect = 2.81e-23 / Id = 88.46SequenceA0A2T6BAE3_9RHOBA0A0B3S8H0_9RHOBA0A6B2PG48_9RHOBUPI000F8F1684A3K3F8_9RHOBA0A0P1G8G8_9RHOBA0A7W6GU79_9RHOBUPI001EE1FD98A0A372EZK5_9RHOBUPI001D0C2827
Match NameE-valueIdentityDescription
A0A2T6BAE3_9RHOB5.200e-2896.15Cbb3-type cytochrome oxidase maturation protein n=... [more]
A0A0B3S8H0_9RHOB2.480e-2692.31Cytochrome c oxidase subunit II n=12 Tax=Rhodobact... [more]
A0A6B2PG48_9RHOB5.880e-2588.46Cbb3-type cytochrome oxidase assembly protein CcoS... [more]
UPI000F8F16841.650e-2486.00cbb3-type cytochrome oxidase assembly protein CcoS... [more]
A3K3F8_9RHOB1.690e-2482.69Cytochrome oxidase maturation protein, cbb3-type n... [more]
A0A0P1G8G8_9RHOB3.330e-2484.00Cytochrome oxidase maturation protein, cbb3-type n... [more]
A0A7W6GU79_9RHOB2.080e-2386.00Cbb3-type cytochrome oxidase maturation protein n=... [more]
UPI001EE1FD982.750e-2386.00cbb3-type cytochrome oxidase assembly protein CcoS... [more]
A0A372EZK5_9RHOB2.810e-2382.69Cbb3-type cytochrome oxidase assembly protein CcoS... [more]
UPI001D0C28272.810e-2388.46cbb3-type cytochrome oxidase assembly protein CcoS... [more]

Pages

back to top