prot_C-australica_Contig_10171.1.1 (polypeptide) Chrysoparadoxa australica CS_1217
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A2T6BAE3_9RHOB (Cbb3-type cytochrome oxidase maturation protein n=4 Tax=Rhodobacterales TaxID=204455 RepID=A0A2T6BAE3_9RHOB) HSP 1 Score: 103 bits (256), Expect = 5.200e-28 Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 NILAYLIPISLILGGLGL FFVFT+RSNQYDDPEGDAQRILSGEYDDHPKQD Sbjct: 2 NILAYLIPISLILGGLGLVFFVFTVRSNQYDDPEGDAQRILSGEYDDHPKQD 53
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A0B3S8H0_9RHOB (Cytochrome c oxidase subunit II n=12 Tax=Rhodobacterales TaxID=204455 RepID=A0A0B3S8H0_9RHOB) HSP 1 Score: 99.0 bits (245), Expect = 2.480e-26 Identity = 48/52 (92.31%), Postives = 49/52 (94.23%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 NIL YLIPISL+LGG GLAFFVFTLRSNQYDDPEGDAQRILSGEYDD PKQD Sbjct: 2 NILTYLIPISLVLGGAGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDRPKQD 53
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A6B2PG48_9RHOB (Cbb3-type cytochrome oxidase assembly protein CcoS n=9 Tax=Roseobacteraceae TaxID=2854170 RepID=A0A6B2PG48_9RHOB) HSP 1 Score: 95.5 bits (236), Expect = 5.880e-25 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 NILAYLIPISLILGGLGLAFFVFT+++ QYDDPEGDAQRILSG+YDD PKQD Sbjct: 2 NILAYLIPISLILGGLGLAFFVFTVKTRQYDDPEGDAQRILSGKYDDRPKQD 53
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: UPI000F8F1684 (cbb3-type cytochrome oxidase assembly protein CcoS n=1 Tax=Shimia sediminis TaxID=2497945 RepID=UPI000F8F1684) HSP 1 Score: 94.4 bits (233), Expect = 1.650e-24 Identity = 43/50 (86.00%), Postives = 49/50 (98.00%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPK 51 N+L+YLIPISLILGG+GL FF+FT+RSNQYDDPEGDAQRILSGE+DDHPK Sbjct: 2 NVLSYLIPISLILGGIGLLFFIFTVRSNQYDDPEGDAQRILSGEWDDHPK 51
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A3K3F8_9RHOB (Cytochrome oxidase maturation protein, cbb3-type n=1 Tax=Sagittula stellata E-37 TaxID=388399 RepID=A3K3F8_9RHOB) HSP 1 Score: 94.4 bits (233), Expect = 1.690e-24 Identity = 43/52 (82.69%), Postives = 49/52 (94.23%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 N+L YLIPISL+LGG+GL FFVFT+RSNQY+DPEGDAQRILSG+YDD PKQD Sbjct: 2 NVLTYLIPISLVLGGMGLLFFVFTIRSNQYEDPEGDAQRILSGDYDDRPKQD 53
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A0P1G8G8_9RHOB (Cytochrome oxidase maturation protein, cbb3-type n=1 Tax=Tropicibacter naphthalenivorans TaxID=441103 RepID=A0A0P1G8G8_9RHOB) HSP 1 Score: 93.6 bits (231), Expect = 3.330e-24 Identity = 42/50 (84.00%), Postives = 48/50 (96.00%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPK 51 NIL YLIPISL+LGG+GL FF+FT+++NQYDDPEGDAQRILSGEYDDHPK Sbjct: 2 NILTYLIPISLVLGGVGLLFFIFTIKTNQYDDPEGDAQRILSGEYDDHPK 51
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A7W6GU79_9RHOB (Cbb3-type cytochrome oxidase maturation protein n=2 Tax=Roseobacteraceae TaxID=2854170 RepID=A0A7W6GU79_9RHOB) HSP 1 Score: 91.7 bits (226), Expect = 2.080e-23 Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPK 51 NIL YLIPISLILGG+GL FF+FT+RSNQYDDPEGDA+RILSGEYDD PK Sbjct: 2 NILTYLIPISLILGGMGLLFFIFTIRSNQYDDPEGDARRILSGEYDDKPK 51
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: UPI001EE1FD98 (cbb3-type cytochrome oxidase assembly protein CcoS n=1 Tax=Mesobacterium pallidum TaxID=2872037 RepID=UPI001EE1FD98) HSP 1 Score: 91.3 bits (225), Expect = 2.750e-23 Identity = 43/50 (86.00%), Postives = 48/50 (96.00%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPK 51 NILAYLIPISLILGG+GLAFFVFT+++ QYDDPEGDAQRILSG+YDD PK Sbjct: 2 NILAYLIPISLILGGIGLAFFVFTVKTRQYDDPEGDAQRILSGDYDDRPK 51
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: A0A372EZK5_9RHOB (Cbb3-type cytochrome oxidase assembly protein CcoS n=1 Tax=Rhodobacteraceae bacterium 63075 TaxID=2301226 RepID=A0A372EZK5_9RHOB) HSP 1 Score: 91.3 bits (225), Expect = 2.810e-23 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 NIL YLIPISL+LGG GLAFF++TLR+NQYDDPEGDA+RILS EYDD PKQD Sbjct: 2 NILTYLIPISLLLGGAGLAFFIYTLRTNQYDDPEGDARRILSDEYDDKPKQD 53
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Match: UPI001D0C2827 (cbb3-type cytochrome oxidase assembly protein CcoS n=1 Tax=Cognatishimia sp. F0-27 TaxID=2816855 RepID=UPI001D0C2827) HSP 1 Score: 91.3 bits (225), Expect = 2.810e-23 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 0 Query: 2 NILAYLIPISLILGGLGLAFFVFTLRSNQYDDPEGDAQRILSGEYDDHPKQD 53 NILAYLIPISLILG LGL FFV+TLRSNQYDDPEGDAQRILS YDD PKQD Sbjct: 2 NILAYLIPISLILGTLGLGFFVWTLRSNQYDDPEGDAQRILSDTYDDRPKQD 53 The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_10171.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-australica_Contig_10171.1.1 ID=prot_C-australica_Contig_10171.1.1|Name=mRNA_C-australica_Contig_10171.1.1|organism=Chrysoparadoxa australica CS_1217|type=polypeptide|length=54bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|