prot_C-australica_Contig_10146.1.1 (polypeptide) Chrysoparadoxa australica CS_1217

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-australica_Contig_10146.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 22
ZOOM
x 1
POSITION
0
MVVGRGGLEPPTSRLSGVRSNHLSYRPRQAGRPDVLLKRYGDGLVRLI*51015202530354045Expect = 5.23e-10 / Id = 70.45Expect = 5.63e-8 / Id = 88.89Expect = 6.68e-8 / Id = 60.47Expect = 4.38e-7 / Id = 59.18Expect = 1.10e-6 / Id = 88.46Expect = 2.27e-6 / Id = 84.62Expect = 2.58e-6 / Id = 84.62Expect = 2.76e-6 / Id = 75.00Expect = 3.01e-6 / Id = 80.77Expect = 3.34e-6 / Id = 88.00SequenceE0XV88_9RHOBA0A2H1Q3R2_XANCHH6SIE5_PARPMA0A0C6FG27_9HYPHA0A653L570_9GAMMQ2G2J6_STAA8A0A382IZR8_9ZZZZUPI001AFAB205W1IX48_9GAMMA0A382FZM2_9ZZZZ
Match NameE-valueIdentityDescription
E0XV88_9RHOB5.230e-1070.45Uncharacterized protein n=1 Tax=uncultured Rhodoba... [more]
A0A2H1Q3R2_XANCH5.630e-888.89Uncharacterized protein n=1 Tax=Xanthomonas campes... [more]
H6SIE5_PARPM6.680e-860.47Uncharacterized protein (Fragment) n=2 Tax=Pararho... [more]
A0A0C6FG27_9HYPH4.380e-759.18Uncharacterized protein n=1 Tax=Methylobacterium a... [more]
A0A653L570_9GAMM1.100e-688.46Uncharacterized protein n=2 Tax=Aeromonas TaxID=64... [more]
Q2G2J6_STAA82.270e-684.62Uncharacterized protein n=1 Tax=Staphylococcus aur... [more]
A0A382IZR8_9ZZZZ2.580e-684.62Uncharacterized protein n=1 Tax=marine metagenome ... [more]
UPI001AFAB2052.760e-675.00Uncharacterized protein n=1 Tax=Citrobacter freund... [more]
W1IX48_9GAMM3.010e-680.77Uncharacterized protein n=1 Tax=Xenorhabdus cabani... [more]
A0A382FZM2_9ZZZZ3.340e-688.00Uncharacterized protein (Fragment) n=1 Tax=marine ... [more]

Pages

back to top