mRNA_C-tenellus_contig10696.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A1Q3CYK1_CEPFO (Uncharacterized protein (Fragment) n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3CYK1_CEPFO) HSP 1 Score: 59.7 bits (143), Expect = 8.900e-9 Identity = 32/78 (41.03%), Postives = 45/78 (57.69%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 W+ DSGCS HMT + + ID K V VT GD K ++ IG++ G + ++ NVS+V GL+ NLLS+ Q Sbjct: 43 WYVDSGCSKHMTGDKSLFIDVKEVDGGKVTFGDNKKAKICGIGSI-------GNKFSTLIENVSYVVGLRHNLLSVSQ 113
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A0K8T6E1_LYGHE (gag_pre-integrs domain-containing protein (Fragment) n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0K8T6E1_LYGHE) HSP 1 Score: 61.2 bits (147), Expect = 2.470e-8 Identity = 28/83 (33.73%), Postives = 50/83 (60.24%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPK-PVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQAGEQ 387 W+ DSG ++H+T L + + P +SSVT G+ L ++ +G+ + G+V + NVS+VPGL++NL+S ++ G + Sbjct: 34 WYIDSGATIHVTGRKDWLTNLREPSTKSSVTTASGEKLPITAVGDTHVLLKIGGKVKKTPIRNVSYVPGLRYNLISCVELGRK 116
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A1Q3DIK0_CEPFO (Uncharacterized protein (Fragment) n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3DIK0_CEPFO) HSP 1 Score: 58.2 bits (139), Expect = 3.180e-8 Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 W+ DSGCS HMT + + ID K V VT GD ++ IG++ G + ++ NVS+V GLK NLLS+ Q Sbjct: 1 WYVDSGCSKHMTGDKSLFIDLKEVDGGKVTFGDNNKAKIVGIGSI-------GNKLSTLIENVSYVVGLKHNLLSVSQ 71
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A0A9WQD4_LYGHE (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) n=2 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9WQD4_LYGHE) HSP 1 Score: 61.2 bits (147), Expect = 3.940e-8 Identity = 28/83 (33.73%), Postives = 50/83 (60.24%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPK-PVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQAGEQ 387 W+ DSG ++H+T L + + P +SSVT G+ L ++ +G+ + G+V + NVS+VPGL++NL+S ++ G + Sbjct: 259 WYIDSGATIHVTGRKDWLTNLREPSTKSSVTTASGEKLPITAVGDTHVLLKIGGKVKKTPIRNVSYVPGLRYNLISCVELGRK 341
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A5B6W7R5_9ROSI (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Gossypium australe TaxID=47621 RepID=A0A5B6W7R5_9ROSI) HSP 1 Score: 60.1 bits (144), Expect = 6.860e-8 Identity = 31/79 (39.24%), Postives = 45/79 (56.96%), Query Frame = 1 Query: 139 IWFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 +W+ DSGCS H+T++ ID KP +T GD Q+ IG++ G+ S+ I+ NV +V G K NLLS+ Q Sbjct: 166 LWYLDSGCSRHITDDKIHFIDLKPKSGRELTFGDNSTKQIKGIGSI-------GKTSSIIIENVLYVSGFKHNLLSISQ 237
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A1Q3BVX3_CEPFO (Uncharacterized protein (Fragment) n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3BVX3_CEPFO) HSP 1 Score: 58.2 bits (139), Expect = 3.940e-7 Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 W+ DSGCS HMT + + ID K V VT GD ++ IG++ G + ++ NVS+V GLK NLLS+ Q Sbjct: 9 WYVDSGCSKHMTGDKSLFIDLKEVDGGKVTFGDNNKAKICGIGSI-------GNNFSTLIENVSYVVGLKHNLLSVSQ 79
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: UPI00080A170B (uncharacterized protein LOC108347874 n=1 Tax=Phaseolus angularis TaxID=3914 RepID=UPI00080A170B) HSP 1 Score: 56.6 bits (135), Expect = 4.280e-7 Identity = 33/83 (39.76%), Postives = 44/83 (53.01%), Query Frame = 1 Query: 127 EVDKIWFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 E + +W+ DSGCS HMT +PT I VT GD +V IG + +S++I+ NV V GLK NLLS+ Q Sbjct: 91 EKEAMWYMDSGCSRHMTRDPTRFISLSYKTSCCVTYGDNNKDKVVGIGKIQ-------TLSSYIIENVLLVDGLKHNLLSINQ 166
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A1Q3DIL5_CEPFO (Uncharacterized protein (Fragment) n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3DIL5_CEPFO) HSP 1 Score: 55.5 bits (132), Expect = 4.330e-7 Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 W+ DSGCS HMT + + ID K V VT D ++ IG++ G + ++ NVS+V GLK NLLS+ Q Sbjct: 6 WYVDSGCSKHMTGDKSLFIDLKEVDGGKVTFRDNNKAKICGIGSI-------GNKFSTLIENVSYVVGLKHNLLSVSQ 76
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A1Q3BGS7_CEPFO (Uncharacterized protein (Fragment) n=1 Tax=Cephalotus follicularis TaxID=3775 RepID=A0A1Q3BGS7_CEPFO) HSP 1 Score: 56.6 bits (135), Expect = 5.970e-7 Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGDGKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQ 375 W+ DSGCS HMT + + I+ K V VT GD ++ IG++ G + ++ NVS+V GLK NLLS+ Q Sbjct: 6 WYVDSGCSKHMTGDKSLFINLKEVDGGKVTFGDNNKAKICGIGSI-------GNKFSTLIENVSYVVGLKHNLLSVSQ 76
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Match: A0A151QLM8_CAJCA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) n=1 Tax=Cajanus cajan TaxID=3821 RepID=A0A151QLM8_CAJCA) HSP 1 Score: 56.6 bits (135), Expect = 1.140e-6 Identity = 34/85 (40.00%), Postives = 46/85 (54.12%), Query Frame = 1 Query: 142 WFCDSGCSVHMTNNPTALIDPKPVVRSSVTVGD---GKVLQVSVIGNLSLSCVQNGEVSNFILHNVSFVPGLKFNLLSMIQAGEQ 387 W+ DSGCS HMT +P+ L+ K VT GD GK+L IGN S+ ++ NV FV GLK+ LLS+ Q ++ Sbjct: 1 WYLDSGCSRHMTGDPSKLLSLKLKNEGFVTYGDNNKGKILGHGNIGN---------STSSTLIENVLFVEGLKYKLLSISQLSDK 76 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10696.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10696.1.1 >prot_C-tenellus_contig10696.1.1 ID=prot_C-tenellus_contig10696.1.1|Name=mRNA_C-tenellus_contig10696.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=144bp MVKGRGVAMQATLMKLVMVNRKWYTSSQLGGFSSVSNDGSIVEVDKIWFCback to top mRNA from alignment at C-tenellus_contig10696:4265..4696- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10696.1.1 ID=mRNA_C-tenellus_contig10696.1.1|Name=mRNA_C-tenellus_contig10696.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=432bp|location=Sequence derived from alignment at C-tenellus_contig10696:4265..4696- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10696:4265..4696- >mRNA_C-tenellus_contig10696.1.1 ID=mRNA_C-tenellus_contig10696.1.1|Name=mRNA_C-tenellus_contig10696.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=432bp|location=Sequence derived from alignment at C-tenellus_contig10696:4265..4696- (Choristocarpus tenellus KU2346)back to top |