mRNA_C-tenellus_contig1063.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig1063.2.1 vs. uniprot
Match: D7FUR4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUR4_ECTSI) HSP 1 Score: 55.5 bits (132), Expect = 1.600e-6 Identity = 33/51 (64.71%), Postives = 35/51 (68.63%), Query Frame = 2 Query: 398 QAKATGKTSSGRMTYQESMAAEKNKQKDLK---MSNERRRATMCEELGRGC 541 QAK GKTSSG+MTY ES AAE KQ+ LK RRRA MCE LGRGC Sbjct: 26 QAKLNGKTSSGQMTYGESRAAEGEKQQRLKDEANDKARRRAAMCENLGRGC 76
BLAST of mRNA_C-tenellus_contig1063.2.1 vs. uniprot
Match: A0A6H5KYI3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYI3_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 4.820e-5 Identity = 32/51 (62.75%), Postives = 35/51 (68.63%), Query Frame = 2 Query: 398 QAKATGKTSSGRMTYQESMAAEKNKQKDLK---MSNERRRATMCEELGRGC 541 QAK GK+SSG+MTY ES AAE KQ+ LK RRRA MCE LGRGC Sbjct: 129 QAKLNGKSSSGQMTYGESRAAEGEKQQRLKDEANDKARRRAAMCENLGRGC 179 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig1063.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig1063.2.1 >prot_C-tenellus_contig1063.2.1 ID=prot_C-tenellus_contig1063.2.1|Name=mRNA_C-tenellus_contig1063.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=83bp MGGNMDNALSRPSGTPYSNRCFNAPVSLYDFFSTQAKATGKTSSGRMTYQback to top mRNA from alignment at C-tenellus_contig1063:8141..9580+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig1063.2.1 ID=mRNA_C-tenellus_contig1063.2.1|Name=mRNA_C-tenellus_contig1063.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1440bp|location=Sequence derived from alignment at C-tenellus_contig1063:8141..9580+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig1063:8141..9580+ >mRNA_C-tenellus_contig1063.2.1 ID=mRNA_C-tenellus_contig1063.2.1|Name=mRNA_C-tenellus_contig1063.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=249bp|location=Sequence derived from alignment at C-tenellus_contig1063:8141..9580+ (Choristocarpus tenellus KU2346)back to top |