mRNA_C-tenellus_contig1040.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig1040.1.1 vs. uniprot
Match: D8LEV4_ECTSI (C2 domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEV4_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 9.720e-9 Identity = 40/88 (45.45%), Postives = 48/88 (54.55%), Query Frame = 1 Query: 61 ELVVGRTWSGSPKVVLRSLWRPLPHEKKRLERWQKKKIFGGS--FRGYKDWTDEHLRLLADEWEFCTAENWGGTTGLGSTYGSAGGLG 318 E +VG+TWSG+P V+LRSL P E RW ++ GG F WTD+ LRLLADEW CT+ GG G G GG G Sbjct: 5393 ERIVGKTWSGAPAVILRSLRVPGRDEAACAARWLRENGEGGGGVFGDDDGWTDQRLRLLADEWTACTSA--GGMPDYGLASGGGGGPG 5478
BLAST of mRNA_C-tenellus_contig1040.1.1 vs. uniprot
Match: A0A6H5KK33_9PHAE (C2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KK33_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 6.100e-8 Identity = 34/68 (50.00%), Postives = 40/68 (58.82%), Query Frame = 1 Query: 61 ELVVGRTWSGSPKVVLRSLWRPLPHEKKRLERWQKKKIFGGS--FRGYKDWTDEHLRLLADEWEFCTA 258 E +VG+TWSGSP V+LRSL P E RW + GG F WTD+ LRLLADEW CT+ Sbjct: 2685 ERIVGKTWSGSPAVILRSLRVPGRDEAVCAARWLRGNGEGGGGVFGDDDGWTDQRLRLLADEWRACTS 2752 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig1040.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig1040.1.1 >prot_C-tenellus_contig1040.1.1 ID=prot_C-tenellus_contig1040.1.1|Name=mRNA_C-tenellus_contig1040.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=147bp RTKCERKVPPVHSVSTPEQWELVVGRTWSGSPKVVLRSLWRPLPHEKKRLback to top mRNA from alignment at C-tenellus_contig1040:1253..1694- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig1040.1.1 ID=mRNA_C-tenellus_contig1040.1.1|Name=mRNA_C-tenellus_contig1040.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=442bp|location=Sequence derived from alignment at C-tenellus_contig1040:1253..1694- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig1040:1253..1694- >mRNA_C-tenellus_contig1040.1.1 ID=mRNA_C-tenellus_contig1040.1.1|Name=mRNA_C-tenellus_contig1040.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=441bp|location=Sequence derived from alignment at C-tenellus_contig1040:1253..1694- (Choristocarpus tenellus KU2346)back to top |