mRNA_C-tenellus_contig9779.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9779.4.1 vs. uniprot
Match: D8LU92_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LU92_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 3.070e-9 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 1 VNEILERYVPNSWSKPMPDAEPNQREQWIWAKYEQR 108 VNEI ERYVP+SW+KP PDA+ QREQW+ AKY+ R Sbjct: 71 VNEIYERYVPSSWTKPTPDADQQQREQWVLAKYKHR 106 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9779.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9779.4.1 >prot_C-tenellus_contig9779.4.1 ID=prot_C-tenellus_contig9779.4.1|Name=mRNA_C-tenellus_contig9779.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=37bp VNEILERYVPNSWSKPMPDAEPNQREQWIWAKYEQR*back to top mRNA from alignment at C-tenellus_contig9779:5575..5685+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9779.4.1 ID=mRNA_C-tenellus_contig9779.4.1|Name=mRNA_C-tenellus_contig9779.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=111bp|location=Sequence derived from alignment at C-tenellus_contig9779:5575..5685+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9779:5575..5685+ >mRNA_C-tenellus_contig9779.4.1 ID=mRNA_C-tenellus_contig9779.4.1|Name=mRNA_C-tenellus_contig9779.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=111bp|location=Sequence derived from alignment at C-tenellus_contig9779:5575..5685+ (Choristocarpus tenellus KU2346)back to top |