mRNA_C-tenellus_contig9655.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9655.1.1 vs. uniprot
Match: D8LD13_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LD13_ECTSI) HSP 1 Score: 90.9 bits (224), Expect = 1.380e-20 Identity = 36/64 (56.25%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 LQGHCCTDVCCSMICTPCMTCQVLGETEDRGSVVDRWSLNTHRPAFEQPWKFGLANYCEDCRHC 192 ++GHCC D+ CS++C PC+TCQ+LGETE RG V D W+ + R EQPWKFGL N +DC C Sbjct: 123 IKGHCCADILCSLVCAPCVTCQLLGETEKRGCVYDSWNDQSARSRREQPWKFGLFNCLDDCTTC 186 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9655.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9655.1.1 >prot_C-tenellus_contig9655.1.1 ID=prot_C-tenellus_contig9655.1.1|Name=mRNA_C-tenellus_contig9655.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=69bp LQGHCCTDVCCSMICTPCMTCQVLGETEDRGSVVDRWSLNTHRPAFEQPWback to top mRNA from alignment at C-tenellus_contig9655:181..387+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9655.1.1 ID=mRNA_C-tenellus_contig9655.1.1|Name=mRNA_C-tenellus_contig9655.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=207bp|location=Sequence derived from alignment at C-tenellus_contig9655:181..387+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9655:181..387+ >mRNA_C-tenellus_contig9655.1.1 ID=mRNA_C-tenellus_contig9655.1.1|Name=mRNA_C-tenellus_contig9655.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=207bp|location=Sequence derived from alignment at C-tenellus_contig9655:181..387+ (Choristocarpus tenellus KU2346)back to top |