mRNA_C-tenellus_contig9498.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Match: A0A6H5KAU5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAU5_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 2.210e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 49 VGSITGSHVCRACGGPRFKRNVCARCGANANDVRG 153 + + G VCRACGGPRF R VCA+CGANAN RG Sbjct: 210 MAELGGGRVCRACGGPRFGRTVCAKCGANANSWRG 244
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Match: D7FMH1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMH1_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 3.010e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 49 VGSITGSHVCRACGGPRFKRNVCARCGANANDVRG 153 + + G VCRACGGPRF R VCA+CGANAN RG Sbjct: 405 MAELGGGRVCRACGGPRFGRTVCAKCGANANSWRG 439 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9498.2.1 >prot_C-tenellus_contig9498.2.1 ID=prot_C-tenellus_contig9498.2.1|Name=mRNA_C-tenellus_contig9498.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=58bp AVFEVNGPQKSDYRDEVGSITGSHVCRACGGPRFKRNVCARCGANANDVRback to top mRNA from alignment at C-tenellus_contig9498:5028..5288- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9498.2.1 ID=mRNA_C-tenellus_contig9498.2.1|Name=mRNA_C-tenellus_contig9498.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=261bp|location=Sequence derived from alignment at C-tenellus_contig9498:5028..5288- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9498:5028..5288- >mRNA_C-tenellus_contig9498.2.1 ID=mRNA_C-tenellus_contig9498.2.1|Name=mRNA_C-tenellus_contig9498.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=174bp|location=Sequence derived from alignment at C-tenellus_contig9498:5028..5288- (Choristocarpus tenellus KU2346)back to top |