prot_C-tenellus_contig9498.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Match: A0A6H5KAU5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAU5_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 5.250e-8 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 17 VGSITGSHVCRACGGPRFKRNVCARCGANANDVRG 51 + + G VCRACGGPRF R VCA+CGANAN RG Sbjct: 210 MAELGGGRVCRACGGPRFGRTVCAKCGANANSWRG 244
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Match: D7FMH1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMH1_ECTSI) HSP 1 Score: 56.6 bits (135), Expect = 6.990e-8 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 17 VGSITGSHVCRACGGPRFKRNVCARCGANANDVRG 51 + + G VCRACGGPRF R VCA+CGANAN RG Sbjct: 405 MAELGGGRVCRACGGPRFGRTVCAKCGANANSWRG 439 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9498.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9498.2.1 ID=prot_C-tenellus_contig9498.2.1|Name=mRNA_C-tenellus_contig9498.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=58bpback to top |