prot_C-tenellus_contig936.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig936.1.1 vs. uniprot
Match: D7G5C7_ECTSI (Chorein N-terminal domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G5C7_ECTSI) HSP 1 Score: 72.4 bits (176), Expect = 4.510e-13 Identity = 40/77 (51.95%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 1 MPFELPHKDVSIAWDLISRKCLIWKSQLGGVDR---EEEEATFRNLSPNVLQALWSIQLQMEAYLPRRLCARCRTMA 74 MP+ELP +DV AW LI+RK W+ + G + +EE A L P VLQALWSIQLQ++A LP R+CA R MA Sbjct: 554 MPWELPQEDVDKAWGLINRKTWRWELRGAGGFKLAIDEERAEQGQLDPAVLQALWSIQLQLDAQLPHRICAFARRMA 630 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig936.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig936.1.1 ID=prot_C-tenellus_contig936.1.1|Name=mRNA_C-tenellus_contig936.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=78bpback to top |