prot_C-tenellus_contig797.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig797.2.1 vs. uniprot
Match: A0A6H5JHH9_9PHAE (Nucleoporin_C domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHH9_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 7.160e-8 Identity = 31/59 (52.54%), Postives = 38/59 (64.41%), Query Frame = 0 Query: 96 SGRVLSHGWAYLCADGAVFAWEQGMVASGGSGTGPS----CLCFDHPSMAGELAAVRAL 150 +GRVLSHGWA++C D V AWEQGMVA+ G CL F+HP+M ELA + L Sbjct: 20 TGRVLSHGWAFMCTDTGVLAWEQGMVAAERPGAAVRADQVCLRFEHPAMMHELALMAPL 78 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig797.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig797.2.1 ID=prot_C-tenellus_contig797.2.1|Name=mRNA_C-tenellus_contig797.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=165bpback to top |