prot_C-tenellus_contig7923.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7923.1.1 vs. uniprot
Match: A0A7S4MWE9_9STRA (Hypothetical protein (Fragment) n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4MWE9_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 6.500e-5 Identity = 25/46 (54.35%), Postives = 30/46 (65.22%), Query Frame = 0 Query: 10 SRSYEYSIRHLYGLEGKMKAFSPQSCRKIAQGWGNGEGGGAHGCPF 55 ++ Y Y+IRHLYG EGK +A SP C KI G G G G HGCP+ Sbjct: 312 TKEYSYTIRHLYGKEGKRQARSPYGCSKIIMGQGPGSGE-HHGCPY 356 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7923.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7923.1.1 ID=prot_C-tenellus_contig7923.1.1|Name=mRNA_C-tenellus_contig7923.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=176bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|