prot_C-tenellus_contig755.5.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig755.5.1 vs. uniprot
Match: A0A835ZK67_9STRA (SKA2 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZK67_9STRA) HSP 1 Score: 89.4 bits (220), Expect = 5.330e-18 Identity = 47/117 (40.17%), Postives = 70/117 (59.83%), Query Frame = 0 Query: 1 MEEHLQLLELDFKSVANDLDFAACRLDTKMAVRGRDETTVPDVHNLLVRIEELQKEVPLLEESMMDVIRRVKAVESTLSTSAVSTHDSMLRVYSRLGCEPDGDWVAEAKSVKAWMQR 117 M+ +Q +EL+FK +AN+L +A+ RLDT MA VPDV+ L+ R+ LQ+ LEE R +A + LS +S+ D M + Y+RLGCE DG+W A A +V+ +Q+ Sbjct: 1 MDSAIQNVELEFKRIANNLQYASHRLDTAMAKAAASGGGVPDVYRLVRRLRALQRTAAQLEEQSQKERARSEACAAELSALLLSSADGMAKAYARLGCEVDGEWAAAADAVRMQLQQ 117 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig755.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig755.5.1 ID=prot_C-tenellus_contig755.5.1|Name=mRNA_C-tenellus_contig755.5.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=150bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|