prot_C-tenellus_contig7426.1.2 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7426.1.2 vs. uniprot
Match: A0A6H5KDE4_9PHAE (SET domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDE4_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.060e-10 Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 19 VRYASYAAIATQRWSRAEGFLRHWLQAMVTMFGAAEVWDIALIQLDLGRVLLK 71 +RYASYAAIATQ W +A FL WL M M+GAAEVWDIA +++D G VL K Sbjct: 375 LRYASYAAIATQSWFKAYSFLSRWLHPMDVMYGAAEVWDIAAMRVDAGLVLDK 427 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7426.1.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7426.1.2 ID=prot_C-tenellus_contig7426.1.2|Name=mRNA_C-tenellus_contig7426.1.2|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=136bpback to top |