prot_C-tenellus_contig727.9.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A6H5KWJ1_9PHAE (Methyltranfer_dom domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KWJ1_9PHAE) HSP 1 Score: 56.2 bits (134), Expect = 5.950e-8 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 I + DY KLMEGTG+LEQVE+ DWAE+T PTWR S Sbjct: 370 ISINDYAKLMEGTGQLEQVETDDWAEQTTPTWRLS 404
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A8J9WID7_9CHLO (2-methyl-6-phytyl-1,4-hydroquinone methyltransferase n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9WID7_9CHLO) HSP 1 Score: 55.5 bits (132), Expect = 1.110e-7 Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 + VQ+YG+L+EGTG+LE VE DW +TLPTWRHS Sbjct: 328 VSVQEYGRLLEGTGKLESVEIDDWTPQTLPTWRHS 362
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: I0Z6S8_COCSC (S-adenosyl-L-methionine-dependent methyltransferase n=1 Tax=Coccomyxa subellipsoidea (strain C-169) TaxID=574566 RepID=I0Z6S8_COCSC) HSP 1 Score: 53.5 bits (127), Expect = 5.300e-7 Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 + VQ+YG+L+EGTG++E V+ DW +TLPTWRHS Sbjct: 269 VSVQEYGRLLEGTGKMESVDIDDWTPQTLPTWRHS 303
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S2UUJ1_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UUJ1_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 5.320e-7 Identity = 22/35 (62.86%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 I +DYG+L+EGTG +EQV + DWA+ETLP+WRH+ Sbjct: 346 ISYEDYGRLVEGTGTMEQVVTDDWAKETLPSWRHA 380
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S3HQH5_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HQH5_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 6.960e-7 Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHSGELVSGMLD 46 I + DY KLM+GTG L+ VE+ADW +TLP+W HS + G+ D Sbjct: 73 ISISDYAKLMQGTGRLQNVETADWTPQTLPSWLHS--IWVGVFD 114
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S3XPM8_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XPM8_HETAK) HSP 1 Score: 53.1 bits (126), Expect = 7.280e-7 Identity = 21/35 (60.00%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 I ++DY KL+EGTG++E+V SA+WA+ET+P+WRH+ Sbjct: 318 ISIEDYVKLIEGTGKMEKVGSANWADETIPSWRHA 352
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S1EXV6_NOCSC (Hypothetical protein n=1 Tax=Noctiluca scintillans TaxID=2966 RepID=A0A7S1EXV6_NOCSC) HSP 1 Score: 50.8 bits (120), Expect = 4.770e-6 Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 I + Y LMEGTG LE V++ADW E+TLP+WRHS Sbjct: 340 ISINSYKDLMEGTGMLEPVKTADWTEQTLPSWRHS 374
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S0VVD3_9CRYP (Hypothetical protein n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0VVD3_9CRYP) HSP 1 Score: 48.9 bits (115), Expect = 5.110e-6 Identity = 18/35 (51.43%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 + +++YG+LM+GTG+LEQV +W +ET+ WRHS Sbjct: 24 VSIEEYGRLMKGTGKLEQVREENWVKETITAWRHS 58
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A0D2MTP6_9CHLO (Methyltransf_11 domain-containing protein n=1 Tax=Monoraphidium neglectum TaxID=145388 RepID=A0A0D2MTP6_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 5.670e-6 Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHSGELVSGMLD 46 I +Q++ +LMEGTG++E V + DW +TLP+WRHS + G+LD Sbjct: 82 ISIQEFCRLMEGTGKMEAVGAEDWTPQTLPSWRHSN--LVGVLD 123
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A0M0K741_9EUKA (Methyltranfer_dom domain-containing protein n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0K741_9EUKA) HSP 1 Score: 50.1 bits (118), Expect = 8.840e-6 Identity = 18/35 (51.43%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 3 ILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 37 I +++YG++M+ TG+L+++ +ADWA ET+P WRHS Sbjct: 248 ISIEEYGRIMQRTGKLQKIVTADWATETIPAWRHS 282 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig727.9.1 ID=prot_C-tenellus_contig727.9.1|Name=mRNA_C-tenellus_contig727.9.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=47bpback to top |