mRNA_C-tenellus_contig718.9.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig718.9.1 vs. uniprot
Match: A0A6H5KZU7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZU7_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 3.770e-6 Identity = 20/26 (76.92%), Postives = 23/26 (88.46%), Query Frame = 1 Query: 4 KNEGTGKLYGEWQTQPWVPEAAVDGK 81 + EGT KLYG+WQT+PW PEAAVDGK Sbjct: 893 EGEGTSKLYGDWQTEPWAPEAAVDGK 918
BLAST of mRNA_C-tenellus_contig718.9.1 vs. uniprot
Match: A0A6G0WLM4_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WLM4_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 6.690e-6 Identity = 23/31 (74.19%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 96 QVASKFGVDYASALVGFESKAGRSVPVLDGI 188 QVA+K G+D+A ALVG+ESKAGRSVP+ DGI Sbjct: 526 QVATKLGIDFAPALVGWESKAGRSVPIFDGI 556
BLAST of mRNA_C-tenellus_contig718.9.1 vs. uniprot
Match: D8LJY2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJY2_ECTSI) HSP 1 Score: 50.8 bits (120), Expect = 9.640e-6 Identity = 19/26 (73.08%), Postives = 23/26 (88.46%), Query Frame = 1 Query: 4 KNEGTGKLYGEWQTQPWVPEAAVDGK 81 + +GT KLYG+WQT+PW PEAAVDGK Sbjct: 845 EGDGTSKLYGDWQTEPWAPEAAVDGK 870 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig718.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig718.9.1 >prot_C-tenellus_contig718.9.1 ID=prot_C-tenellus_contig718.9.1|Name=mRNA_C-tenellus_contig718.9.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=63bp EKNEGTGKLYGEWQTQPWVPEAAVDGKGITLGRSHPSLVWIMHLHWLGLSback to top mRNA from alignment at C-tenellus_contig718:12930..13358- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig718.9.1 ID=mRNA_C-tenellus_contig718.9.1|Name=mRNA_C-tenellus_contig718.9.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=429bp|location=Sequence derived from alignment at C-tenellus_contig718:12930..13358- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig718:12930..13358- >mRNA_C-tenellus_contig718.9.1 ID=mRNA_C-tenellus_contig718.9.1|Name=mRNA_C-tenellus_contig718.9.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=189bp|location=Sequence derived from alignment at C-tenellus_contig718:12930..13358- (Choristocarpus tenellus KU2346)back to top |