prot_C-tenellus_contig9869.3.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9869.3.1 vs. uniprot
Match: A0A6H5KV46_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV46_9PHAE) HSP 1 Score: 100 bits (249), Expect = 9.630e-23 Identity = 48/92 (52.17%), Postives = 66/92 (71.74%), Query Frame = 0 Query: 54 YLIAAAGIKAMTEHMQDIERGRNLKQRIASWADRAGLDLPSVEPALGFLDVLGVSRATVYKSLMESALQTLLDMIPQLDKEVLVALLLDSFR 145 YL+ AG + +T ++QD+ +GR R+ W + AGL PSV+ ALGFLD+LGVSRA+VYK L+E +L+ LLD IP L + VL+ LL DSF+ Sbjct: 72 YLVGMAGHRTLTSYIQDLSKGRRWTDRVRGWGEEAGLAEPSVKLALGFLDILGVSRASVYKQLLEDSLRVLLDQIPHLPENVLLDLLTDSFK 163 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9869.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9869.3.1 ID=prot_C-tenellus_contig9869.3.1|Name=mRNA_C-tenellus_contig9869.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=146bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|