prot_C-tenellus_contig9844.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5L1A0_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1A0_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.820e-12 Identity = 31/47 (65.96%), Postives = 36/47 (76.60%), Query Frame = 0 Query: 1 NVF-LDTSELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 NVF L ELG CTI +ADFPLEP T+P+ RAPYRTNP + +IDKC Sbjct: 139 NVFSLSPKELGKCTIAKADFPLEPGTKPVDRAPYRTNPRAQEVIDKC 185
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5KKE6_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKE6_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 1.340e-11 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 1 NVF-LDTSELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 NVF L ELG C I +ADFPLEP T+P+ RAPYRTNP + +IDKC Sbjct: 139 NVFSLSPKELGKCRIAKADFPLEPGTKPVDRAPYRTNPRAQEVIDKC 185
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5JAT6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAT6_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 9.290e-10 Identity = 25/40 (62.50%), Postives = 28/40 (70.00%), Query Frame = 0 Query: 7 SELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 SELG CTI EA FP+ P TRP+ R PYR NP V + DKC Sbjct: 2 SELGRCTIAEATFPVPPGTRPVDRPPYRPNPRVATVSDKC 41
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5JGV3_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGV3_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 3.730e-9 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 4 LDTSELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 L SELG CTI EA FP+ P TRP+ R PYR NP V + DKC Sbjct: 150 LSMSELGRCTIAEATFPVPPGTRPVDRPPYRPNPRVATVSDKC 192
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5JXY7_9PHAE (RT_RNaseH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXY7_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 3.730e-9 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 4 LDTSELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 L SELG CTI EA FP+ P TRP+ R PYR NP V + DKC Sbjct: 151 LSMSELGRCTIAEATFPVPPGTRPVDRPPYRPNPRVATVSDKC 193
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5K112_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K112_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 3.730e-9 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 4 LDTSELGICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 L SELG CTI EA FP+ P TRP+ R PYR NP V + DKC Sbjct: 150 LSMSELGRCTIAEATFPVPPGTRPVDRPPYRPNPRVATVSDKC 192
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Match: A0A6H5JK17_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK17_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 7.630e-7 Identity = 24/40 (60.00%), Postives = 27/40 (67.50%), Query Frame = 0 Query: 8 ELG-ICTITEADFPLEPDTRPISRAPYRTNPHVRGIIDKC 46 ELG CTI EA FP+ P TRP+ R PYR NP V + DKC Sbjct: 3 ELGRCCTIAEATFPVPPGTRPVDRPPYRPNPRVATVSDKC 42 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9844.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9844.1.1 ID=prot_C-tenellus_contig9844.1.1|Name=mRNA_C-tenellus_contig9844.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=48bpback to top |