prot_C-tenellus_contig9792.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: D8LDX3_ECTSI (Exocyst subunit Exo70 family protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LDX3_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 4.130e-12 Identity = 35/60 (58.33%), Postives = 45/60 (75.00%), Query Frame = 0 Query: 3 VDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKV 62 V+ L AGL +FE ++ QM GI ++FE RLGKLE+E+LPMK IS LS +RRNI AI K+ Sbjct: 17 VEILGAGLTSFESSTRQMKGICEDFEGRLGKLEREMLPMKEISAKLSTSRRNIISAIEKM 76
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: UPI001B8628AE (Cullin repeat-like-containing domain protein n=1 Tax=Suillus clintonianus TaxID=1904413 RepID=UPI001B8628AE) HSP 1 Score: 52.0 bits (123), Expect = 3.880e-6 Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 0 Query: 1 AAVDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKVGE 64 A ++ L L Q S +M+ I NF+TRL +LEK ILP+ N ++ L L NI +A+ K+ E Sbjct: 6 AEIELLEQNLNKTVQISQRMTSILTNFDTRLARLEKSILPLYNSTQKLKLLAHNIDRALLKIDE 69
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: A0A0D0ALA3_9AGAM (Exocyst complex protein EXO70 n=8 Tax=Suillus TaxID=5379 RepID=A0A0D0ALA3_9AGAM) HSP 1 Score: 50.4 bits (119), Expect = 1.360e-5 Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 0 Query: 1 AAVDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKVGE 64 A ++ L L Q S +M+ I NF+TRL KLEK ILP+ N ++ L NI +A+ K+ E Sbjct: 6 AEIELLEQNLNKTHQISQRMTSILTNFDTRLVKLEKSILPLYNSTQKLKQRAHNIDRALLKIDE 69
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: A0A1J8R5N5_9AGAM (Uncharacterized protein (Fragment) n=1 Tax=Rhizopogon vesiculosus TaxID=180088 RepID=A0A1J8R5N5_9AGAM) HSP 1 Score: 48.5 bits (114), Expect = 2.650e-5 Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 0 Query: 1 AAVDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKVGE 64 A ++ L L Q S +M+ I NF+TRL K+E+ ILP+ N ++ L NI +A+ K+ E Sbjct: 6 AEIELLEQNLNKTRQISQRMTSILTNFDTRLMKIERSILPLYNSTQKLKQRAHNIDRALLKIDE 69
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: A0A1B7MQL9_9AGAM (Exocyst complex protein EXO70 n=1 Tax=Rhizopogon vinicolor AM-OR11-026 TaxID=1314800 RepID=A0A1B7MQL9_9AGAM) HSP 1 Score: 48.5 bits (114), Expect = 6.520e-5 Identity = 24/64 (37.50%), Postives = 37/64 (57.81%), Query Frame = 0 Query: 1 AAVDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKVGE 64 A ++ L L Q S +M+ I NF+TRL K+E+ ILP+ N ++ L NI +A+ K+ E Sbjct: 6 AEIELLEQNLNKTRQISQRMTSILTNFDTRLVKIERSILPLYNSTQKLKQRAHNIDRALLKIDE 69
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Match: A0A0C9V1V2_9AGAM (Exocyst complex protein EXO70 n=1 Tax=Hydnomerulius pinastri MD-312 TaxID=994086 RepID=A0A0C9V1V2_9AGAM) HSP 1 Score: 48.1 bits (113), Expect = 8.930e-5 Identity = 24/64 (37.50%), Postives = 38/64 (59.38%), Query Frame = 0 Query: 1 AAVDTLRAGLRNFEQASTQMSGIYDNFETRLGKLEKEILPMKNISENLSLARRNITKAIAKVGE 64 A ++ L L Q S +M+ I NF++RL KLEK ILP+ ++ L+ NI +A++K+ E Sbjct: 6 AEIELLEQNLNKTHQISQRMTSILTNFDSRLVKLEKSILPLYTATQKLNQRSHNIDRALSKIDE 69 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9792.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9792.2.1 ID=prot_C-tenellus_contig9792.2.1|Name=mRNA_C-tenellus_contig9792.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=64bpback to top |