prot_C-tenellus_contig7868.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A6H5KN68_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN68_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 4.360e-6 Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVFREHVKFVRNM 51 IDVRHHFL +LA + +I VI V + QR D LTK+L F H FV N+ Sbjct: 592 IDVRHHFLWELAERKEISVIHVPSPYQRADFLTKSLSKDAFESHRDFVMNL 642
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A438HLL6_VITVI (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Vitis vinifera TaxID=29760 RepID=A0A438HLL6_VITVI) HSP 1 Score: 49.3 bits (116), Expect = 2.100e-5 Identity = 22/50 (44.00%), Postives = 35/50 (70.00%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVFREHVKFVRN 50 IDVR HFLR+LA++G I ++ G+ +Q D++TK L + VF++ K + N Sbjct: 621 IDVRFHFLRNLAKEGTIELVHCGSQDQVADIMTKPLKLEVFQKFRKLLGN 670
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A5BDF0_VITVI (Uncharacterized protein n=1 Tax=Vitis vinifera TaxID=29760 RepID=A5BDF0_VITVI) HSP 1 Score: 47.8 bits (112), Expect = 2.890e-5 Identity = 21/48 (43.75%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVFREHVKFV 48 IDVR HFLR+LA++G I ++ G+ +Q D++TK L + VF++ K + Sbjct: 91 IDVRFHFLRNLAKEGTIELVHCGSQDQVADIMTKPLKLEVFQKFRKLL 138
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A438CJ15_VITVI (Retrovirus-related Pol polyprotein from transposon RE1 n=1 Tax=Vitis vinifera TaxID=29760 RepID=A0A438CJ15_VITVI) HSP 1 Score: 47.8 bits (112), Expect = 5.730e-5 Identity = 21/48 (43.75%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVFREHVKFV 48 IDVR HFLR+LA++G I ++ G+ +Q D++TK L + VF++ K + Sbjct: 164 IDVRFHFLRNLAKEGTIELVHCGSQDQVADIMTKPLKLEVFQKFRKLL 211
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A438K365_VITVI (Retrovirus-related Pol polyprotein from transposon RE2 n=1 Tax=Vitis vinifera TaxID=29760 RepID=A0A438K365_VITVI) HSP 1 Score: 45.8 bits (107), Expect = 6.800e-5 Identity = 20/43 (46.51%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVFRE 43 IDVR HFLR+LA+ G I ++ G+ +Q D++TK L + VF++ Sbjct: 41 IDVRFHFLRNLAKDGTIELLHCGSQDQVVDIMTKPLKLEVFQK 83
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A438ICZ7_VITVI (Retrovirus-related Pol polyprotein from transposon RE1 n=1 Tax=Vitis vinifera TaxID=29760 RepID=A0A438ICZ7_VITVI) HSP 1 Score: 45.8 bits (107), Expect = 7.220e-5 Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVF 41 +DVR HFLRDLA++ ++++ GT +Q D+LTK L + VF Sbjct: 44 MDVRFHFLRDLAKEEVVKLVHCGTNDQVVDILTKPLKLEVF 84
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Match: A0A6H5K0A8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0A8_9PHAE) HSP 1 Score: 47.0 bits (110), Expect = 9.490e-5 Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 1 IDVRHHFLRDLARKGKIRVIFVGTVNQRTDVLTKNLPVRVF 41 IDVRHHFLR+LA +G + + V + Q D+LTK LP +F Sbjct: 151 IDVRHHFLRNLAEEGVLEIRHVSSEGQHADILTKALPRDLF 191 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7868.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7868.1.1 ID=prot_C-tenellus_contig7868.1.1|Name=mRNA_C-tenellus_contig7868.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=52bpback to top |