prot_C-tenellus_contig7793.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7793.2.1 vs. uniprot
Match: D7FT18_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT18_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 5.910e-17 Identity = 35/66 (53.03%), Postives = 50/66 (75.76%), Query Frame = 0 Query: 4 YGLGKRVPRKQVAEIMKYVRDQTQELDIEEKRWFSSVGIVCMVFGVLLLLMRVAVGDLRTNPTPQR 69 YGLG++VPR +VA IM+YV+ Q +LD++E RWF+ +GIVC VFG +L+L+RV VG + P +R Sbjct: 96 YGLGRKVPRAKVARIMQYVQRQIDDLDVKEGRWFTGIGIVCFVFGGVLILLRVVVGSIFPQPPSRR 161
BLAST of mRNA_C-tenellus_contig7793.2.1 vs. uniprot
Match: A0A6H5L4Y3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4Y3_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 1.560e-16 Identity = 35/66 (53.03%), Postives = 50/66 (75.76%), Query Frame = 0 Query: 4 YGLGKRVPRKQVAEIMKYVRDQTQELDIEEKRWFSSVGIVCMVFGVLLLLMRVAVGDLRTNPTPQR 69 YGLG++VPR +VA IM+YV+ Q +LD++E RWF+ +GIVC VFG +L+L+RV VG + P +R Sbjct: 144 YGLGRKVPRAKVARIMQYVQRQIDDLDVKEGRWFTGIGIVCFVFGGVLILLRVVVGSIFPQPPSRR 209
BLAST of mRNA_C-tenellus_contig7793.2.1 vs. uniprot
Match: A0A835YLB3_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YLB3_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 5.320e-15 Identity = 33/64 (51.56%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 1 MTKYGLGKRVPRKQVAEIMKYVRDQTQELDIEEKRWFSSVGIVCMVFGVLLLLMRVAVGDLRTN 64 M+ GLG++VPR +V EIMKY++ + E+D+ + R+ S VG++C +FGVLLLLMR AVG+L ++ Sbjct: 116 MSSRGLGRQVPRSRVQEIMKYIKREIHEVDVSQARYTSGVGLICCIFGVLLLLMRAAVGNLSSS 179 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7793.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7793.2.1 ID=prot_C-tenellus_contig7793.2.1|Name=mRNA_C-tenellus_contig7793.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=80bpback to top |