prot_C-tenellus_contig7694.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7694.1.1 vs. uniprot
Match: A0A6H5KY01_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY01_9PHAE) HSP 1 Score: 92.4 bits (228), Expect = 1.700e-22 Identity = 47/81 (58.02%), Postives = 62/81 (76.54%), Query Frame = 0 Query: 25 DFGVMSCYRGFVISCMEDDWLTDTLSDDEVGLPEGHDLAMDDGEVDLGESMDAMEKEENKWTELGIDAL-QREGQAPSSSS 104 DFG +S Y GF + ++ W T LSDDE+ LPEGHD+ +DDGEVDLGES++A E+EE KWT+ GID L QREG AP++++ Sbjct: 5 DFGAVSLYAGF-LDITDEAWTTADLSDDEIDLPEGHDVVVDDGEVDLGESIEAAEQEELKWTDKGIDLLLQREGGAPTANT 84
BLAST of mRNA_C-tenellus_contig7694.1.1 vs. uniprot
Match: A0A0P1AZ02_PLAHL (Apc13p n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1AZ02_PLAHL) HSP 1 Score: 48.1 bits (113), Expect = 3.470e-5 Identity = 23/60 (38.33%), Postives = 39/60 (65.00%), Query Frame = 0 Query: 33 RGFVISCMEDDWLTDTLSDDEVGLPEGHDLAMDDGEVDLGE-SMDAMEKEENKWTELGID 91 R + ++DDW+ DTLSDDE+ +P D+ ++ E GE SM E+++++W +LG+D Sbjct: 11 RKLFLDIVDDDWIKDTLSDDEIEIPLALDVDLNGSESPTGEPSMWTAEEKKDRWNDLGLD 70 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7694.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7694.1.1 ID=prot_C-tenellus_contig7694.1.1|Name=mRNA_C-tenellus_contig7694.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=105bpback to top |