prot_C-tenellus_contig740.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig740.4.1 vs. uniprot
Match: A0A7S3JZR8_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JZR8_9STRA) HSP 1 Score: 72.4 bits (176), Expect = 7.190e-14 Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 0 Query: 1 MERCSDTDGS----FNICDVWVAPYTQTAVAIPSNSTYLRVQQCTFTEDSPE----CLSDPIPVEIYGSPILWPSSVDINYSVATRC 79 M RCS GS F +C W+ P T TA+AIP N++Y+R++ C + + E CL +P P++ YG+ + +PSS+D+ + A C Sbjct: 69 MNRCSPRPGSNEEPFLLCPYWIPPETFTALAIPLNASYVRMEYCVYNDQDEEPHYHCLDNPQPIDFYGTEVFFPSSIDVAAAQAPFC 155
BLAST of mRNA_C-tenellus_contig740.4.1 vs. uniprot
Match: A0A7S2SLL9_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SLL9_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 9.300e-9 Identity = 31/95 (32.63%), Postives = 49/95 (51.58%), Query Frame = 0 Query: 1 MERCSDTDGSFNICDVWVAPYTQTAVAIPSNSTYLRVQQCTF---------------TEDSPEC-LSDPIPVEIYGSPILWPSSVDINYSVATRC 79 M RC D +F +C W+ P T T +AIP NSTY+++++ + T+D L +P P E YG+ +WPS++DI ++ C Sbjct: 119 MRRCDDA--TFKVCPFWIPPRTFTGLAIPKNSTYIKMERTVYLQKRLADEWNVSWTRTDDFVAAVLRNPPPEEYYGTEEMWPSTIDIEFAENHFC 211 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig740.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig740.4.1 ID=prot_C-tenellus_contig740.4.1|Name=mRNA_C-tenellus_contig740.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=81bpback to top |