prot_C-tenellus_contig732.6.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig732.6.1 vs. uniprot
Match: A0A6H5L901_9PHAE (LsmAD domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L901_9PHAE) HSP 1 Score: 50.1 bits (118), Expect = 1.270e-5 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 4 NACRLAVQIEGRDSVNRHCREERNRMTPQDLAMGEEERYSSV 45 +A R+A +IEG+ S N H REERN +T QD AMGEEER+S V Sbjct: 289 HAERMAAEIEGKTSSNIHMREERNMLTEQDKAMGEEERFSGV 330
BLAST of mRNA_C-tenellus_contig732.6.1 vs. uniprot
Match: D7FVW6_ECTSI (LsmAD domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVW6_ECTSI) HSP 1 Score: 49.7 bits (117), Expect = 1.740e-5 Identity = 26/42 (61.90%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 4 NACRLAVQIEGRDSVNRHCREERNRMTPQDLAMGEEERYSSV 45 +A R+A +IEG+ S N H REERN +T QD AMGEEER+S V Sbjct: 291 HAERMAAEIEGKTSGNIHMREERNMLTEQDKAMGEEERFSGV 332 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig732.6.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig732.6.1 ID=prot_C-tenellus_contig732.6.1|Name=mRNA_C-tenellus_contig732.6.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|