prot_C-tenellus_contig7094.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7094.4.1 vs. uniprot
Match: A0A816SFT4_9BILA (Hypothetical protein n=1 Tax=Rotaria magnacalcarata TaxID=392030 RepID=A0A816SFT4_9BILA) HSP 1 Score: 58.9 bits (141), Expect = 4.620e-9 Identity = 28/38 (73.68%), Postives = 34/38 (89.47%), Query Frame = 0 Query: 2 LVKEESCFDKGLIALQTSRELEEIITLIPDENISAKPI 39 ++KE+S FD+GLIALQ S+EL+EIITLIPDENI KPI Sbjct: 650 VIKEDSHFDEGLIALQMSQELDEIITLIPDENIPVKPI 687
BLAST of mRNA_C-tenellus_contig7094.4.1 vs. uniprot
Match: UPI000F8EC01F (TM0106 family RecB-like putative nuclease n=2 Tax=Legionellaceae TaxID=444 RepID=UPI000F8EC01F) HSP 1 Score: 50.4 bits (119), Expect = 4.530e-6 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 2 LVKEESCFDKGLIALQTSRELEEIITLIPDENISAKPI 39 ++K +S +G IALQT ELEE+ITLIPDE+I AKPI Sbjct: 650 VIKGDSSLGEGYIALQTGEELEEMITLIPDEDIQAKPI 687 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7094.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7094.4.1 ID=prot_C-tenellus_contig7094.4.1|Name=mRNA_C-tenellus_contig7094.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=39bpback to top |