prot_C-tenellus_contig6880.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6880.2.1 vs. uniprot
Match: A0A6H5KY61_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY61_9PHAE) HSP 1 Score: 99.4 bits (246), Expect = 2.720e-20 Identity = 45/77 (58.44%), Postives = 55/77 (71.43%), Query Frame = 0 Query: 144 LSQLSEKNVQTDKVCERNWRRGTCSHDLLCVAKDTIQHLQWKGGELAFGTDKGGIFIVSFDTGSVIESFKGHDGEVT 220 +S L ++ V+ D+VC NWR+GTCSHDLL A D IQHL+W G LAFGTD GG +I+S TG VI F+GH G VT Sbjct: 157 ISALRKREVEIDRVCAYNWRKGTCSHDLLFQAADPIQHLRWVGDHLAFGTDGGGTWIISRQTGFVINVFEGHSGAVT 233 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6880.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6880.2.1 ID=prot_C-tenellus_contig6880.2.1|Name=mRNA_C-tenellus_contig6880.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=239bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|